Sequence of DPV Eggplant mottled crinkle virus

Eggplant mottled crinkle virus coat protein mRNA, complete cds.

ACC No: EU327529

Dated: 2011-12-21 | Length: 1243 | CRC: 440126390

                
ID   EU327529; SV 1; linear; mRNA; STD; VRL; 1243 BP.
XX
AC   EU327529;
XX
DT   01-JAN-2009 (Rel. 98, Created)
DT   21-DEC-2011 (Rel. 111, Last updated, Version 2)
XX
DE   Eggplant mottled crinkle virus coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Eggplant mottled crinkle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1243
RA   Rasoulpour R., Izadpanah K.;
RT   "Isolation and Partial Characterization of Pelargonium leaf curl virus,
RT   Moroccan pepper virus";
RL   J. Phytopathol. 159:802-804(2011).
XX
RN   [2]
RP   1-1243
RA   Rasoulpour R., Izadpanah K.;
RT   ;
RL   Submitted (04-DEC-2007) to the INSDC.
RL   Plant Pathology, Plant Virology Research Center, Shiraz, Fars, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1243
FT                   /organism="Eggplant mottled crinkle virus"
FT                   /strain="EMCV-S"
FT                   /mol_type="mRNA"
FT                   /country="Iran"
FT                   /isolation_source="soil near Datura stramonium roots"
FT                   /collected_by="R. Rasoulpour"
FT                   /collection_date="2005"
FT                   /identified_by="R. Rasoulpour"
FT                   /db_xref="taxon:270256"
FT   CDS             41. .1207
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:B8PYF7"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:B8PYF7"
FT                   /protein_id="ACA49239.1"
FT                   /translation="MEIVRRNNNNAIAINKKQLASMAATAAAGALSNYVKNNGAMIVQG
FT                   AVNMGKKAYGVVRNRKNKGNSQAMVHVGGMGGAMMAPVAVSRQLVGSKPKFAGRTAGSV
FT                   TVTHREYLTQVNNSPAFTTNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYVFNSVVLH
FT                   YVPLCGTNEVGRVAMYWDKDSEDPEPVDRVELANFGILKETAPWAEAILRVPTDKTKRY
FT                   CDDSTVVDRKLIDLGQLGISTYGGAGTNPVGDVFVSYSVTLYFPQPTNTLLSTRQLSLT
FT                   GALEASTGPGXINVAHTPTLLTITFRSTGTFLLSGVFRDTSVAVLGVTGGIGINSQTTL
FT                   DVVGVATSFLVNCTVSTLPATLTYGSVGITSVTANCTRATRANTATLL"
XX
SQ   Sequence 1243 BP; 333 A; 286 C; 320 G; 303 T; 1 other;

eu327529 Length: 1243  21-DEC-2011  Type: N  Check: 8726  ..

       1  tccgccgtgg catgaccaag tgaacacaag cggcatagca atggaaatcg
      51  ttaggagaaa caataataat gcaatcgcaa tcaacaagaa acaactggcc
     101  tctatggcgg ctactgccgc cgctggggct cttagcaatt atgtgaagaa
     151  caatggagca atgattgtac aaggtgcggt gaatatgggc aagaaagctt
     201  atggagtagt aaggaaccgt aagaataagg gtaattcaca ggcaatggtg
     251  cacgtaggtg gtatgggcgg ggctatgatg gcccctgtgg cagtatctcg
     301  gcaacttgtg ggcagtaagc caaagttcgc aggtaggact gctggatcag
     351  tcacagtcac ccaccgtgag tacttaaccc aggtgaacaa ctcccctgct
     401  tttacaacca atggagggat tgtcgggaat ttgttacaac tcaacccgct
     451  taatggcaca ctgttttcgt ggttaccggc tatcgcgtcg aacttcgatc
     501  agtacgtctt taacagcgtt gtgttacatt atgtccccct ctgtggcaca
     551  aatgaagtag ggcgtgttgc aatgtactgg gataaggact ctgaggatcc
     601  tgagcctgtg gatagagtgg aattagctaa tttcggtata cttaaagaga
     651  cggccccatg ggccgaagct attttgaggg tcccaactga taagacgaaa
     701  cgatactgcg atgacagtac agtggttgac aggaagctta tcgacctcgg
     751  acagctcgga atatctacat atggaggagc cggaactaat cctgtggggg
     801  atgtgtttgt gtcgtatagc gttacgcttt acttcccaca acccacgaat
     851  accctactca gtacgcgaca gcttagcctt actggcgcct tagaagcatc
     901  tactgggccc ggawatatta acgtagcaca tacaccaaca ctcttgacta
     951  taacattcag gtccaccgga actttcctgc tttcaggagt tttccgggac
    1001  actagtgttg ctgttcttgg tgtgacgggg ggcataggaa ttaatagtca
    1051  aaccacactt gatgttgttg gcgtagccac atcatttctt gtgaactgta
    1101  cagtgtccac actacccgcc acactcacat atggatctgt agggataaca
    1151  tctgttactg cgaattgcac acgggccacc agggccaata ccgcaacatt
    1201  gctatagtcg cctaggggtc tcttgaacag accagttcat gga