Sequence of DPV Tomato leaf curl New Delhi virus
Tomato leaf curl New Delhi virus coat protein gene, complete cds.
ACC No: EU375489
Dated: 2008-02-05 | Length: 771 | CRC: -1358316805
ID EU375489; SV 1; linear; genomic DNA; STD; VRL; 771 BP. XX AC EU375489; XX DT 05-FEB-2008 (Rel. 94, Created) DT 05-FEB-2008 (Rel. 94, Last updated, Version 1) XX DE Tomato leaf curl New Delhi virus coat protein gene, complete cds. XX KW . XX OS Tomato leaf curl New Delhi virus OC Viruses; ssDNA viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-771 RA Raj S.K., Snehi S.K., Khan M.S.; RT "Association of Tomato leaf curl New Delhi virus (ToLCNDV) with leaf curl RT disease of Solanum tuberosum (potato) in U.P., India"; RL Unpublished. XX RN [2] RP 1-771 RA Raj S.K., Snehi S.K., Khan M.S.; RT ; RL Submitted (07-JAN-2008) to the EMBL/GenBank/DDBJ databases. RL Molecular Plant Virology Lab, National Botanical Research Institute, Rana RL Pratap Marg, Lucknow, U.P. 226001, India XX FH Key Location/Qualifiers FH FT source 1. .771 FT /organism="Tomato leaf curl New Delhi virus" FT /specific_host="Solanum tuberosum (potato)" FT /mol_type="genomic DNA" FT /country="India:Ganzaria, Lucknow" FT /collected_by="S.K. Raj" FT /collection_date="2006" FT /virion FT /db_xref="taxon:223347" FT CDS 1. .771 FT /codon_start=1 FT /product="coat protein" FT /protein_id="ABY84645.1" FT /translation="MVKRPADIIFSTPASKVRRRLNFDSPFGARAVVPIARVTKAKAWT FT NRPMNRKPRIYRMYRSPDVPRGCEGPCKVQSFESRHDVSHIGKVMCVSDVTRGSGLTHR FT VGKRFCVKSVYVLGKIWMDENIKTKNHTNSVMFFLVRDRRPTGSPQDFGEVFNMFDNEP FT STATVKNMHRDRYQVLRKWHATVTGGTYASKEQALVSKFVRGNNYVVYNQQEAGKYENH FT TENALMLYMACTHASNPVYATLKIRIYFYDSVTN" XX SQ Sequence 771 BP; 227 A; 159 C; 186 G; 199 T; 0 other; eu375489 Length: 771 05-FEB-2008 Type: N Check: 986 .. 1 atggtgaagc gaccagcaga tatcatcttt tcaacgcccg catcgaaagt 51 acgccgacgt ctcaacttcg acagcccctt tggagctcgt gcagttgtcc 101 ccattgcccg cgtcacaaaa gcaaaggcct ggaccaacag gccgatgaac 151 agaaaaccca gaatatacag aatgtataga agtcccgacg tgccaagggg 201 atgcgaaggc ccttgtaagg tgcagtcctt tgaatctagg cacgatgtct 251 ctcatattgg caaagtcatg tgtgttagtg atgttacccg aggatctgga 301 ctcacccatc gcgtagggaa gcgattttgt gtgaaatctg tctatgtgct 351 ggggaagata tggatggatg aaaacatcaa gacaaaaaac catactaaca 401 gtgtcatgtt ttttttggtc cgtgaccgtc gtcctacagg atctccacaa 451 gattttgggg aagtttttaa catgtttgac aatgaaccga gcacagcaac 501 ggtgaagaac atgcatcgtg atcgttatca agtcttacgg aagtggcatg 551 ctactgtgac gggaggaaca tatgcatcta aggagcaagc attagttagc 601 aagtttgtta ggggtaataa ttatgttgtg tataaccaac aagaggccgg 651 caagtatgag aatcatactg aaaacgcatt aatgttgtat atggcctgta 701 ctcatgcatc aaatcctgtg tatgctactt tgaaaatccg gatctatttc 751 tatgattcgg taacaaatta a