Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate sang24 p23 gene, partial cds.

ACC No: EU487601

Dated: 2008-03-18 | Length: 612 | CRC: 890691556

                
ID   EU487601; SV 1; linear; genomic RNA; STD; VRL; 612 BP.
XX
AC   EU487601;
XX
DT   18-MAR-2008 (Rel. 95, Created)
DT   18-MAR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate sang24 p23 gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-612
RA   Catara A., Lombardo A., Nobile G., Rizza S.;
RT   "Characterization of additional Citrus tristeza virus isolates in a higly
RT   citrus infected area of Sicily";
RL   Unpublished.
XX
RN   [2]
RP   1-612
RA   Catara A., Lombardo A., Nobile G., Rizza S.;
RT   ;
RL   Submitted (14-FEB-2008) to the EMBL/GenBank/DDBJ databases.
RL   Laboratorio di Analisi Genomica e Rispondenza Varietale, Parco Scientifico
RL   e Tecnologico della Sicilia, Stadale V. Lancia, Catania, CT 95121, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .612
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus sinensis cv. Sanguinello"
FT                   /isolate="sang24"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /db_xref="taxon:12162"
FT   CDS             <1. .>612
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="ACA81386.1"
FT                   /translation="GQTFVSVNLSDESNTASTEIKAVSSEADRLEFLRKMNPFIIDALI
FT                   RKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDPVKYLN
FT                   KGKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEHYKFGM
FT                   TAKAMLPDINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 612 BP; 185 A; 123 C; 156 G; 148 T; 0 other;

eu487601 Length: 612  18-MAR-2008  Type: N  Check: 4783  ..

       1  ggacaaactt tcgtttctgt gaacctttct gacgaaagca acacagctag
      51  tactgaaatc aaagccgtaa gttcggaagc ggatcgcttg gaatttttac
     101  ggaaaatgaa tcccttcatt atcgacgctt tgatacggaa aaatagttat
     151  caaggcgctc gctttcgcgc gagaataata ggagtgtgcg tggattgtgg
     201  tagaaaacac gataaggcat cgaggactga acgtaagtgt aaggtcaaca
     251  atacgcagtc tcagaacgag gtggcgcata tgttaatgca cgatcccgta
     301  aaatatttaa ataaaggaaa agctagagcc ttttctaacg cagagatgtt
     351  tgcgatcgat ttggttatgc acaccaaaga aaggcaatta gcggttgatt
     401  tggccgctga aagggagaag acgagattgg ctcgtagaca cccgatgcgt
     451  tctccggaag agactccgga acattataaa ttcggtatga ctgctaaggc
     501  aatgttaccg gacatcaacg ctgtagacgt tggtgataac gaagacacct
     551  cgtcggagta cccagtaagt ctgagtgttt ccggcggagt tctccgtgaa
     601  caccacttca tc