Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate TDV1 p23 gene, partial cds.

ACC No: EU487603

Dated: 2008-03-18 | Length: 612 | CRC: 1247320178

                
ID   EU487603; SV 1; linear; genomic RNA; STD; VRL; 612 BP.
XX
AC   EU487603;
XX
DT   18-MAR-2008 (Rel. 95, Created)
DT   18-MAR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate TDV1 p23 gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-612
RA   Catara A., Lombardo A., Nobile G., Rizza S.;
RT   "Characterization of additional Citrus tristeza virus isolates in a higly
RT   citrus infected area of Sicily";
RL   Unpublished.
XX
RN   [2]
RP   1-612
RA   Catara A., Lombardo A., Nobile G., Rizza S.;
RT   ;
RL   Submitted (14-FEB-2008) to the EMBL/GenBank/DDBJ databases.
RL   Laboratorio di Analisi Genomica e Rispondenza Varietale, Parco Scientifico
RL   e Tecnologico della Sicilia, Stadale V. Lancia, Catania, CT 95121, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .612
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus sinensis cv. Tarocco TDV"
FT                   /isolate="TDV1"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /db_xref="taxon:12162"
FT   CDS             <1. .>612
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="ACA81388.1"
FT                   /translation="GQTFVSVNLSDESNTASTKVENVKSEADRLEFLRKMNPFIVDALV
FT                   RKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDPVKYLN
FT                   KRKARAFSNAEMFAIELVFYTKERQLAVDLAAEREKTRLARRHPIRSPEETPEHYKFGM
FT                   TAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 612 BP; 183 A; 122 C; 158 G; 149 T; 0 other;

eu487603 Length: 612  18-MAR-2008  Type: N  Check: 4553  ..

       1  ggacaaactt tcgtttctgt gaacctttct gacgaaagca acacggcaag
      51  cactaaagta gaaaacgtaa aatcggaagc ggatcgcttg gaatttttac
     101  gtaaaatgaa tccctttatt gttgacgctc tggtgcggaa aaccaattat
     151  cagggtgctc gctttcgcgc aagaataata ggagtgtgcg tggattgtgg
     201  tagaaaacac gacaaggcgc tcaagactga acgtaagtgt aaggtcaaca
     251  atacgcaatc tcagaacgag gtggcgcata tgttgatgca cgatcccgtt
     301  aagtatttga acaagagaaa ggctagagcc ttttctaacg cagagatgtt
     351  tgcgattgaa ttggtttttt acaccaagga aaggcaattg gcggttgatt
     401  tagccgctga aagggagaag acgagactgg ctcgtagaca cccaatacgt
     451  tctccggaag aaactccgga acattataaa ttcggtatga ctgctaaggc
     501  aatgttaccg gacatcaacg ccgtagacgt tggtgataac gaggaaactt
     551  cgtcggagta cccagtgagt ctgagtgttt ctggcggagt tctccgtgaa
     601  caccacttca tc