Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate PeraIAC-41 coat protein mRNA, complete cds.

ACC No: EU579353

Dated: 2009-01-13 | Length: 672 | CRC: -2018749808

                
ID   EU579353; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   EU579353;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate PeraIAC-41 coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18992281.
RA   Nolasco G., Santos C., Silva G., Fonseca F.;
RT   "Development of an asymmetric PCR-ELISA typing method for citrus tristeza
RT   virus based on the coat protein gene";
RL   J. Virol. Methods 155(2):97-108(2009).
XX
RN   [2]
RP   1-672
RA   Astua J., Santos C., Nolasco G.;
RT   ;
RL   Submitted (19-MAR-2008) to the EMBL/GenBank/DDBJ databases.
RL   BioFIG, University of Algarve, Campus de Gambelas, Faro, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="PeraIAC-41"
FT                   /mol_type="mRNA"
FT                   /country="Brazil"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACE77090.1"
FT                   /translation="MDDETKKXKNKNKEAKEGDDVVAAXXSFXSLNFHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIRAKEQLLKKRGADEIVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 192 A; 127 C; 171 G; 178 T; 4 other;

eu579353 Length: 672  13-JAN-2009  Type: N  Check: 1686  ..

       1  atggacgacg aaacaaagaa attkaagaac aaaaacaagg aagcgaaaga
      51  aggcgacgat gttgttgcag cggaktyttc tttcgkttcc ttaaacttcc
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagacaaaga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacgagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaaatcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga