Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C257-7-2 coat protein mRNA, complete cds.

ACC No: EU579377

Dated: 2009-01-13 | Length: 672 | CRC: -1596386004

                
ID   EU579377; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   EU579377;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate C257-7-2 coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18992281.
RA   Nolasco G., Santos C., Silva G., Fonseca F.;
RT   "Development of an asymmetric PCR-ELISA typing method for citrus tristeza
RT   virus based on the coat protein gene";
RL   J. Virol. Methods 155(2):97-108(2009).
XX
RN   [2]
RP   1-672
RA   la Plata I., Santos C., Nolasco G.;
RT   ;
RL   Submitted (19-MAR-2008) to the EMBL/GenBank/DDBJ databases.
RL   BioFIG, University of Algarve, Campus de Gambelas, Faro, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C257-7-2"
FT                   /mol_type="mRNA"
FT                   /country="Argentina"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACE77114.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 122 C; 170 G; 184 T; 0 other;

eu579377 Length: 672  13-JAN-2009  Type: N  Check: 4633  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaataagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataaaga ctttcactta gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggagt tgtctgacaa
     351  actttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga