Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C320-5-22 coat protein mRNA, complete cds.

ACC No: EU579381

Dated: 2009-01-13 | Length: 672 | CRC: 475856172

                
ID   EU579381; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   EU579381;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate C320-5-22 coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18992281.
RA   Nolasco G., Santos C., Silva G., Fonseca F.;
RT   "Development of an asymmetric PCR-ELISA typing method for citrus tristeza
RT   virus based on the coat protein gene";
RL   J. Virol. Methods 155(2):97-108(2009).
XX
RN   [2]
RP   1-672
RA   la Plata I., Santos C., Nolasco G.;
RT   ;
RL   Submitted (19-MAR-2008) to the EMBL/GenBank/DDBJ databases.
RL   BioFIG, University of Algarve, Campus de Gambelas, Faro, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C320-5-22"
FT                   /mol_type="mRNA"
FT                   /country="Argentina"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACE77118.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTSALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 125 C; 172 G; 179 T; 0 other;

eu579381 Length: 672  13-JAN-2009  Type: N  Check: 2623  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcgtcgt tacaaagcga cgatgatacc
     301  acgggtatga cgtacactcg ggaaggtgtt gaagtggaac tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  gcgcccttcg agtctggggt agatctaacg acgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga