Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate TT1-4 coat protein mRNA, complete cds.

ACC No: EU579390

Dated: 2009-01-13 | Length: 672 | CRC: 1891040244

                
ID   EU579390; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   EU579390;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate TT1-4 coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18992281.
RA   Nolasco G., Santos C., Silva G., Fonseca F.;
RT   "Development of an asymmetric PCR-ELISA typing method for citrus tristeza
RT   virus based on the coat protein gene";
RL   J. Virol. Methods 155(2):97-108(2009).
XX
RN   [2]
RP   1-672
RA   StHill A., Santos C., Nolasco G., Umaharan P.;
RT   ;
RL   Submitted (19-MAR-2008) to the EMBL/GenBank/DDBJ databases.
RL   BioFIG, University of Algarve, Campus de Gambelas, Faro, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="TT1-4"
FT                   /mol_type="mRNA"
FT                   /country="Trinidad and Tobago"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACE77127.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKCPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDIVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAREQLLKKRGDDEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 125 C; 170 G; 180 T; 0 other;

eu579390 Length: 672  13-JAN-2009  Type: N  Check: 657  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacaat gttgtagctg ccgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactttgata acgatgaacg atgtgcgtca gttgggcacc
     151  caacagaacg ctgctttgaa cagagactta ttccttactt tgaaagggaa
     201  gtgtcctaac ttacctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgtct agcagttaag agttcatcat tacaaagcga tgacgacgcc
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgtctgataa
     351  actttggact gacatcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgcagacaga atcgcaattt gagttatggc ggacgtccgc tagacgcagg
     501  gattccggcc gggtatcatt acttgtgtgc ggatttcttg actggagctg
     551  gtttgactga cttagaatgt gctgtgtaca tacaagctag agaacaatta
     601  ttgaagaagc gaggggatga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga