Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate S133-31 coat protein mRNA, complete cds.

ACC No: EU579405

Dated: 2009-01-13 | Length: 672 | CRC: 1887066178

                
ID   EU579405; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   EU579405;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate S133-31 coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18992281.
RA   Nolasco G., Santos C., Silva G., Fonseca F.;
RT   "Development of an asymmetric PCR-ELISA typing method for citrus tristeza
RT   virus based on the coat protein gene";
RL   J. Virol. Methods 155(2):97-108(2009).
XX
RN   [2]
RP   1-672
RA   Myers L., Santos C., Nolasco G.;
RT   ;
RL   Submitted (19-MAR-2008) to the EMBL/GenBank/DDBJ databases.
RL   BioFIG, University of Algarve, Campus de Gambelas, Faro, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="S133-31"
FT                   /mol_type="mRNA"
FT                   /country="Jamaica"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACE77142.1"
FT                   /translation="MDDETKKLKNKDKETKEGDNVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTRDGVEVELSDKLWTDIVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 199 A; 121 C; 169 G; 183 T; 0 other;

eu579405 Length: 672  13-JAN-2009  Type: N  Check: 4299  ..

       1  atggacgacg aaacaaagaa attgaagaac aaggacaagg aaacgaaaga
      51  aggcgacaat gttgttgcgg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactttgata gcgatgaacg atgtacgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ttttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggatggtgtt gaagtggaat tgtctgacaa
     351  actttggaca gacatcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagccg
     551  gcttgactga tttagaatgt gcagtgtaca tacaagctaa agagcaatta
     601  ttaaagaaac gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga