Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate K4-20 coat protein mRNA, complete cds.

ACC No: EU579408

Dated: 2009-01-13 | Length: 672 | CRC: -1118858757

                
ID   EU579408; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   EU579408;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate K4-20 coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18992281.
RA   Nolasco G., Santos C., Silva G., Fonseca F.;
RT   "Development of an asymmetric PCR-ELISA typing method for citrus tristeza
RT   virus based on the coat protein gene";
RL   J. Virol. Methods 155(2):97-108(2009).
XX
RN   [2]
RP   1-672
RA   Santos C., Nolasco G.;
RT   ;
RL   Submitted (19-MAR-2008) to the EMBL/GenBank/DDBJ databases.
RL   BioFIG, University of Algarve, Campus de Gambelas, Faro, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="K4-20"
FT                   /mol_type="mRNA"
FT                   /country="Tunisia"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACE77145.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFSSVNLHNDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQGDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLGCAVYIQAEEQLLKKRGADDVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 193 A; 124 C; 172 G; 183 T; 0 other;

eu579408 Length: 672  13-JAN-2009  Type: N  Check: 2929  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacaaaaga
      51  aggcgacgat gttgttgctg ccgagtcttc tttcagttcc gtaaacttac
     101  acaacgatcc gactttgata acgatgaacg atgtgcgtca gttgagtacc
     151  caacagaacg ctgctttgaa cagagactta ttccttactt tgaaagggaa
     201  gtatcctaac ttacctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaggcga tgacgacgcc
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgcagacaga atcgcaattt gagttatggc ggacgtccgc tagacgcggg
     501  gattccggcc gggtatcatt acttgtgtgc ggatttcttg actggagctg
     551  gtttgactga tttaggatgt gctgtgtaca tacaagctga agaacaattg
     601  ttgaagaagc gaggggctga tgatgtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga