Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate K1-76 coat protein mRNA, complete cds.

ACC No: EU579411

Dated: 2009-01-13 | Length: 672 | CRC: 1011745633

                
ID   EU579411; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   EU579411;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate K1-76 coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18992281.
RA   Nolasco G., Santos C., Silva G., Fonseca F.;
RT   "Development of an asymmetric PCR-ELISA typing method for citrus tristeza
RT   virus based on the coat protein gene";
RL   J. Virol. Methods 155(2):97-108(2009).
XX
RN   [2]
RP   1-672
RA   Amin H., Santos C., Nolasco G.;
RT   ;
RL   Submitted (19-MAR-2008) to the EMBL/GenBank/DDBJ databases.
RL   BioFIG, University of Algarve, Campus de Gambelas, Faro, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="K1-76"
FT                   /mol_type="mRNA"
FT                   /country="Tunisia"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACE77148.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSANLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPSLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGAGEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 121 C; 177 G; 183 T; 0 other;

eu579411 Length: 672  13-JAN-2009  Type: N  Check: 5092  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gcgaatttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ctgctttgaa cagagatttg tttcttactc tgaaagggaa
     201  gtatcctagc ttgtctgaca aggataagga cttccacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggcataa catatactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaatta
     601  ttaaagaagc gaggggctgg tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga