Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 440-4 coat protein mRNA, complete cds.

ACC No: EU579415

Dated: 2009-01-13 | Length: 672 | CRC: 390103451

                
ID   EU579415; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   EU579415;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate 440-4 coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18992281.
RA   Nolasco G., Santos C., Silva G., Fonseca F.;
RT   "Development of an asymmetric PCR-ELISA typing method for citrus tristeza
RT   virus based on the coat protein gene";
RL   J. Virol. Methods 155(2):97-108(2009).
XX
RN   [2]
RP   1-672
RA   Cerni S., Santos C., Martins V., Nolasco G.;
RT   ;
RL   Submitted (19-MAR-2008) to the EMBL/GenBank/DDBJ databases.
RL   BioFIG, University of Algarve, Campus de Gambelas, Faro, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="440-4"
FT                   /mol_type="mRNA"
FT                   /country="Croatia"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACE77152.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSINLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 201 A; 129 C; 164 G; 178 T; 0 other;

eu579415 Length: 672  13-JAN-2009  Type: N  Check: 84  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaataagg aaacgaaaga
      51  aggcgacaac gttgttgccg ctgagtcttc tttcggttcc ataaacttac
     101  acatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaaa agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgt tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga