Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 441-2 coat protein mRNA, complete cds.

ACC No: EU579418

Dated: 2009-01-13 | Length: 672 | CRC: 657980306

                
ID   EU579418; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   EU579418;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate 441-2 coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18992281.
RA   Nolasco G., Santos C., Silva G., Fonseca F.;
RT   "Development of an asymmetric PCR-ELISA typing method for citrus tristeza
RT   virus based on the coat protein gene";
RL   J. Virol. Methods 155(2):97-108(2009).
XX
RN   [2]
RP   1-672
RA   Cerni S., Santos C., Martins V., Nolasco G.;
RT   ;
RL   Submitted (19-MAR-2008) to the EMBL/GenBank/DDBJ databases.
RL   BioFIG, University of Algarve, Campus de Gambelas, Faro, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="441-2"
FT                   /mol_type="mRNA"
FT                   /country="Croatia"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACE77155.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGIEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGVGLTDLECAVYIQAKEQLLKKRGADEVAVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 193 A; 125 C; 176 G; 178 T; 0 other;

eu579418 Length: 672  13-JAN-2009  Type: N  Check: 661  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gtgaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ccgcattgaa cagagacttg tttcttactc tgaaagggaa
     201  gtatcctaac ttgcctgaca aggataagga tttccacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggtataa catatactcg ggagggtatt gaagtggatc tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactccaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggatatcatt acctatgtgc agatttcttg accggagttg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgca gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga