Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 447-5 coat protein mRNA, complete cds.

ACC No: EU579427

Dated: 2009-01-13 | Length: 672 | CRC: 1142686158

                
ID   EU579427; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   EU579427;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate 447-5 coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18992281.
RA   Nolasco G., Santos C., Silva G., Fonseca F.;
RT   "Development of an asymmetric PCR-ELISA typing method for citrus tristeza
RT   virus based on the coat protein gene";
RL   J. Virol. Methods 155(2):97-108(2009).
XX
RN   [2]
RP   1-672
RA   Cerni S., Santos C., Martins V., Nolasco G.;
RT   ;
RL   Submitted (19-MAR-2008) to the EMBL/GenBank/DDBJ databases.
RL   BioFIG, University of Algarve, Campus de Gambelas, Faro, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="447-5"
FT                   /mol_type="mRNA"
FT                   /country="Croatia"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACE77164.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 192 A; 125 C; 175 G; 180 T; 0 other;

eu579427 Length: 672  13-JAN-2009  Type: N  Check: 2504  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacacc
     301  acgggcataa cgtacactcg agagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttggaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga