Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 398-4 coat protein mRNA, complete cds.

ACC No: EU579431

Dated: 2009-01-13 | Length: 672 | CRC: 1732297963

                
ID   EU579431; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   EU579431;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate 398-4 coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18992281.
RA   Nolasco G., Santos C., Silva G., Fonseca F.;
RT   "Development of an asymmetric PCR-ELISA typing method for citrus tristeza
RT   virus based on the coat protein gene";
RL   J. Virol. Methods 155(2):97-108(2009).
XX
RN   [2]
RP   1-672
RA   Zemzami M., Nolasco G.;
RT   ;
RL   Submitted (19-MAR-2008) to the EMBL/GenBank/DDBJ databases.
RL   BioFIG, University of Algarve, Campus de Gambelas, Faro, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="398-4"
FT                   /mol_type="mRNA"
FT                   /country="Morocco"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACE77168.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAGSSFGSLNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 194 A; 131 C; 168 G; 179 T; 0 other;

eu579431 Length: 672  13-JAN-2009  Type: N  Check: 1335  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ctgggtcctc tttcggttcc ttaaacttac
     101  acatcgatcc aactctgata acgatgaatg acgtgcgtca gttgagtacc
     151  caacagaacg ctgctttaaa cagagacttg tttcttactt tgaaagggaa
     201  gtatcctaac ttacctgaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tacaaagcga tgacgacact
     301  acgggcataa cgtacactcg ggagggtgtt gaagtggatt tgtccgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgctgg
     501  gattccggcc gggtaccatt acctgtgtgc tgatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga