Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate SCTV6 coat protein gene, partial cds.

ACC No: EU626555

Dated: 2010-09-07 | Length: 670 | CRC: -864640997

                
ID   EU626555; SV 1; linear; genomic RNA; STD; VRL; 670 BP.
XX
AC   EU626555;
XX
DT   01-MAY-2008 (Rel. 95, Created)
DT   07-SEP-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate SCTV6 coat protein gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-670
RX   AGRICOLA; IND44148924.
RX   DOI; 10.1094/PDIS-92-10-1468C.
RA   Abou Kubaa R., Djelouah K., D'Onghia A.M., Addante R., Jamal M.;
RT   "First Report from Syria of Citrus tristeza virus in Citrus spp";
RL   Plant Dis. 92(10):1468-1468(2008).
XX
RN   [2]
RP   1-670
RA   D'Onghia A.M., Abou Kubaa R., Jamal M., Djelouah K.;
RT   ;
RL   Submitted (09-APR-2008) to the EMBL/GenBank/DDBJ databases.
RL   IPM, IAM-Bari, Via Ceglie, 9, Valenzano, BA 70010, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .670
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sp."
FT                   /isolate="SCTV6"
FT                   /mol_type="genomic RNA"
FT                   /country="Syria:Tartous"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .>670
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:B2MW27"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B2MW27"
FT                   /protein_id="ACC85672.1"
FT                   /translation="MDDETKKLKNKNKETKEDDNVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RRLSTQQNVALNRDLFLTLKEKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 670 BP; 190 A; 123 C; 173 G; 184 T; 0 other;

eu626555 Length: 670  07-SEP-2010  Type: N  Check: 8733  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  agacgacaat gttgttgcag cggagtcttc tttcggttct gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtcg gttgagtacc
     151  caacagaatg tcgctttgaa cagagatttg tttcttactt tgaaagagaa
     201  gtatcctaat ttgtctgata aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt aggactaacg atgcccttta tttagccttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagagtgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacccgtt