Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate T3 clone 21 coat protein (CP) gene, complete cds.

ACC No: EU660906

Dated: 2012-02-09 | Length: 672 | CRC: -485402390

                
ID   EU660906; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU660906;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   09-FEB-2012 (Rel. 111, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate T3 clone 21 coat protein (CP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Cerni S., Skoric D., Ruscic J., Krajacic M., Papic T., Djelouah K.,
RA   Nolasco G.;
RT   "East Adriatic - a reservoir region of severe Citrus tristeza virus
RT   strains";
RL   Eur. J. Plant Pathol. 124(4):701-706(2009).
XX
RN   [2]
RP   1-672
RA   Papic T., Djelouah K., Santos C., Nolasco G.;
RT   ;
RL   Submitted (18-APR-2008) to the INSDC.
RL   Center for Biodiversity Functional and Integrative Genomics, Universidade
RL   do Algarve, Campus de Gambelas, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="T3"
FT                   /mol_type="genomic RNA"
FT                   /country="Montenegro"
FT                   /isolation_source="Citrus unshiu"
FT                   /clone="21"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:B9UIV6"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B9UIV6"
FT                   /protein_id="ACF76934.1"
FT                   /translation="MDDETKTLKNKNKETKEGDDVVAAESSFSSINLHIDPTLIAMNDV
FT                   RQLGTRQNAALNRGLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRANALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 194 A; 132 C; 170 G; 176 T; 0 other;

eu660906 Length: 672  09-FEB-2012  Type: N  Check: 9158  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ccgagtcttc tttcagttcc ataaacttac
     101  acatcgatcc aactttgata gcgatgaatg acgtgcgtca gttgggtacc
     151  cgacagaacg ccgctttgaa cagaggctta tttctcactt tgaaagggaa
     201  gcatcctaac ttacctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggact tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgcgcta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaactt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga