Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 444 clone 2 coat protein (CP) gene, complete cds.

ACC No: EU660912

Dated: 2012-02-09 | Length: 672 | CRC: -1784227657

                
ID   EU660912; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU660912;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   09-FEB-2012 (Rel. 111, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate 444 clone 2 coat protein (CP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Cerni S., Skoric D., Ruscic J., Krajacic M., Papic T., Djelouah K.,
RA   Nolasco G.;
RT   "East Adriatic - a reservoir region of severe Citrus tristeza virus
RT   strains";
RL   Eur. J. Plant Pathol. 124(4):701-706(2009).
XX
RN   [2]
RP   1-672
RA   Cerni S., Santos C., Martins V., Nolasco G.;
RT   ;
RL   Submitted (18-APR-2008) to the INSDC.
RL   Biology, University of Zagreb, Faculty of Science, Marulicev trg 9a, Zagreb
RL   HR-10000, Croatia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="444"
FT                   /mol_type="genomic RNA"
FT                   /country="Croatia"
FT                   /isolation_source="Citrus unshiu"
FT                   /clone="2"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:B1P5F3"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B1P5F3"
FT                   /protein_id="ACF76940.1"
FT                   /translation="MDDETKTLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 125 C; 169 G; 180 T; 0 other;

eu660912 Length: 672  09-FEB-2012  Type: N  Check: 3271  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcaatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgacacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggagt tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga