Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 445 clone 2 coat protein (CP) gene, complete cds.

ACC No: EU660914

Dated: 2012-02-09 | Length: 672 | CRC: -173693348

                
ID   EU660914; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU660914;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   09-FEB-2012 (Rel. 111, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate 445 clone 2 coat protein (CP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Cerni S., Skoric D., Ruscic J., Krajacic M., Papic T., Djelouah K.,
RA   Nolasco G.;
RT   "East Adriatic - a reservoir region of severe Citrus tristeza virus
RT   strains";
RL   Eur. J. Plant Pathol. 124(4):701-706(2009).
XX
RN   [2]
RP   1-672
RA   Cerni S., Santos C., Martins V., Nolasco G.;
RT   ;
RL   Submitted (18-APR-2008) to the INSDC.
RL   Biology, University of Zagreb, Faculty of Science, Marulicev trg 9a, Zagreb
RL   HR-10000, Croatia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="445"
FT                   /mol_type="genomic RNA"
FT                   /country="Croatia"
FT                   /isolation_source="Citrus unshiu"
FT                   /clone="2"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:B9UIW4"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B9UIW4"
FT                   /protein_id="ACF76942.1"
FT                   /translation="MDDETKTLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTEAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 203 A; 131 C; 160 G; 178 T; 0 other;

eu660914 Length: 672  09-FEB-2012  Type: N  Check: 8787  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc aactctgata acgatgaatg acgtgcgtca gttgagtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacccgaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaaa agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagccttt
     451  tgtagacaga atcgcaactt aagttatggc ggacgtccgt tagatgcagg
     501  gattccagcc gggtatcatt acctgtgtgc agatttcttg accgaagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga