Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Q8 clone 1 coat protein (CP) gene, complete cds.

ACC No: EU660916

Dated: 2012-02-09 | Length: 672 | CRC: 872861188

                
ID   EU660916; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU660916;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   09-FEB-2012 (Rel. 111, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate Q8 clone 1 coat protein (CP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Cerni S., Skoric D., Ruscic J., Krajacic M., Papic T., Djelouah K.,
RA   Nolasco G.;
RT   "East Adriatic - a reservoir region of severe Citrus tristeza virus
RT   strains";
RL   Eur. J. Plant Pathol. 124(4):701-706(2009).
XX
RN   [2]
RP   1-672
RA   Cerni S., Santos C., Martins V., Nolasco G.;
RT   ;
RL   Submitted (18-APR-2008) to the INSDC.
RL   Biology, University of Zagreb, Faculty of Science, Marulicev trg 9a, Zagreb
RL   HR-10000, Croatia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Q8"
FT                   /mol_type="genomic RNA"
FT                   /country="Albania"
FT                   /isolation_source="Citrus limon"
FT                   /clone="1"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:B9UIW6"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B9UIW6"
FT                   /protein_id="ACF76944.1"
FT                   /translation="MDDETKTLKNKNKETKEGDDVVAAESSFSSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 128 C; 167 G; 179 T; 0 other;

eu660916 Length: 672  09-FEB-2012  Type: N  Check: 8764  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaagg aaacaaaaga
      51  aggcgacgat gttgttgctg ccgagtcttc tttcagttcc gtaaacttac
     101  acatcgatcc gactttgata acgatgaacg atgtgcgtca gttgagtacc
     151  caacagaacg ctgctttgaa cagagactta ttccttactt tgaaagggaa
     201  gcatcctaac ttacctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcac tacaaagcga tgacgacgcc
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggaat tgtctgacaa
     351  actttggact gacgtcgtgt ttaactctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgcagacaga atcgcaattt gagttatggc ggacgtccgc tagacgcagg
     501  gattccggcc gggtatcatt acttgtgtgc ggatttcttg actggagctg
     551  gtttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaatta
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga