Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 45J clone B coat protein (CP) gene, complete cds.

ACC No: EU660924

Dated: 2012-02-09 | Length: 672 | CRC: -1979949707

                
ID   EU660924; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU660924;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   09-FEB-2012 (Rel. 111, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate 45J clone B coat protein (CP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Cerni S., Skoric D., Ruscic J., Krajacic M., Papic T., Djelouah K.,
RA   Nolasco G.;
RT   "East Adriatic - a reservoir region of severe Citrus tristeza virus
RT   strains";
RL   Eur. J. Plant Pathol. 124(4):701-706(2009).
XX
RN   [2]
RP   1-672
RA   Cerni S., Ruscic J., Skoric D.;
RT   ;
RL   Submitted (18-APR-2008) to the INSDC.
RL   Biology, University of Zagreb, Faculty of Science, Marulicev trg 9a, Zagreb
RL   HR-10000, Croatia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="45J"
FT                   /mol_type="genomic RNA"
FT                   /country="Croatia"
FT                   /isolation_source="Citrus unshiu"
FT                   /clone="B"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:B9UIX4"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B9UIX4"
FT                   /protein_id="ACF76952.1"
FT                   /translation="MDDETKTLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYVQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 128 C; 168 G; 180 T; 0 other;

eu660924 Length: 672  09-FEB-2012  Type: N  Check: 455  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc aactctgata acgatgaatg acgtacgtca gctgagtacc
     151  caacagaacg ctgctttaaa cagagacttg tttcttactt tgaaagggaa
     201  gtatcctaac ttacctgaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaggtggatt tgtccgacaa
     351  actttggact gatgtcgtgt ataactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgt tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga cttggaatgt gctgtgtacg tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga