Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 16J clone 6-2 coat protein (CP) gene, complete cds.

ACC No: EU660928

Dated: 2012-02-09 | Length: 672 | CRC: -1841474228

                
ID   EU660928; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU660928;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   09-FEB-2012 (Rel. 111, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate 16J clone 6-2 coat protein (CP) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Cerni S., Skoric D., Ruscic J., Krajacic M., Papic T., Djelouah K.,
RA   Nolasco G.;
RT   "East Adriatic - a reservoir region of severe Citrus tristeza virus
RT   strains";
RL   Eur. J. Plant Pathol. 124(4):701-706(2009).
XX
RN   [2]
RP   1-672
RA   Cerni S., Ruscic J., Skoric D.;
RT   ;
RL   Submitted (18-APR-2008) to the INSDC.
RL   Biology, University of Zagreb, Faculty of Science, Marulicev trg 9a, Zagreb
RL   HR-10000, Croatia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="16J"
FT                   /mol_type="genomic RNA"
FT                   /country="Croatia"
FT                   /isolation_source="Citrus limon"
FT                   /clone="6-2"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:B9UIX8"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B9UIX8"
FT                   /protein_id="ACF76956.1"
FT                   /translation="MDDETKTLKNKNRETKEGDDVVAAESSFGSLNFHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEIVVTNVRRLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 190 A; 133 C; 175 G; 174 T; 0 other;

eu660928 Length: 672  09-FEB-2012  Type: N  Check: 9976  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaggg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggctcc ttaaacttcc
     101  acatcgatcc gactctgata gcgatgaacg acgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagacaaaga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagcga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgcgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaggctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaaatcgta gttaccaatg tcaggcggct
     651  tgggaaattc aacacacgtt ga