Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 43J clone 6-1 coat protein (CP) gene, complete cds.

ACC No: EU660932

Dated: 2012-02-09 | Length: 672 | CRC: 342575964

                
ID   EU660932; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU660932;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   09-FEB-2012 (Rel. 111, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate 43J clone 6-1 coat protein (CP) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Cerni S., Skoric D., Ruscic J., Krajacic M., Papic T., Djelouah K.,
RA   Nolasco G.;
RT   "East Adriatic - a reservoir region of severe Citrus tristeza virus
RT   strains";
RL   Eur. J. Plant Pathol. 124(4):701-706(2009).
XX
RN   [2]
RP   1-672
RA   Cerni S., Ruscic J., Skoric D.;
RT   ;
RL   Submitted (18-APR-2008) to the INSDC.
RL   Biology, University of Zagreb, Faculty of Science, Marulicev trg 9a, Zagreb
RL   HR-10000, Croatia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="43J"
FT                   /mol_type="genomic RNA"
FT                   /country="Croatia"
FT                   /isolation_source="Citrus unshiu"
FT                   /clone="6-1"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:B9UIY2"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B9UIY2"
FT                   /protein_id="ACF76960.1"
FT                   /translation="MDDETKTLKNKNNETKEGDDVVAAESSYGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAAYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 199 A; 128 C; 168 G; 177 T; 0 other;

eu660932 Length: 672  09-FEB-2012  Type: N  Check: 977  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaacg aaacaaaaga
      51  aggcgacgat gttgttgcgg ccgagtcttc ttacggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagagactta tttcttactc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacgtcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt atctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgcgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga