Sequence of DPV Tomato yellow leaf curl virus
Tomato yellow leaf curl virus isolate Ch12 precoat protein (V2) gene, complete cds; and coat protein (V1) gene, partial cds.
ACC No: EU677429
Dated: 2009-03-23 | Length: 510 | CRC: 1999455436
ID EU677429; SV 1; linear; genomic DNA; STD; VRL; 510 BP. XX AC EU677429; XX DT 02-AUG-2008 (Rel. 96, Created) DT 23-MAR-2009 (Rel. 100, Last updated, Version 2) XX DE Tomato yellow leaf curl virus isolate Ch12 precoat protein (V2) gene, DE complete cds; and coat protein (V1) gene, partial cds. XX KW . XX OS Tomato yellow leaf curl virus OC Viruses; ssDNA viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-510 RX PUBMED; 19112612. RA Fazeli R., Heydarnejad J., Massumi H., Shaabanian M., Varsani A.; RT "Genetic diversity and distribution of tomato-infecting begomoviruses in RT Iran"; RL Virus Genes 38(2):311-319(2009). XX RN [2] RP 1-510 RA Heydarnejad J., Fazeli R., Massumi H.; RT ; RL Submitted (23-APR-2008) to the EMBL/GenBank/DDBJ databases. RL Plant Protection Department, Shahid Bahonar University of Kerman, 22 Bahman RL Ave, Kerman, Kerman 7616914111, Iran XX FH Key Location/Qualifiers FH FT source 1. .510 FT /organism="Tomato yellow leaf curl virus" FT /host="Chrozophora hierosolymitana" FT /isolate="Ch12" FT /mol_type="genomic DNA" FT /country="Iran:Kerman, Jiroft" FT /db_xref="taxon:10832" FT gene 127. .474 FT /gene="V2" FT CDS 127. .474 FT /codon_start=1 FT /gene="V2" FT /product="precoat protein" FT /db_xref="GOA:B4YT05" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:B4YT05" FT /protein_id="ACF04184.1" FT /translation="MWDPLLHEFPESVHGLRCMLAVKYLKEIEKTYSPDTIGYDLVRDL FT ISVVRARNYGEASSRYLHFNARIESTPSSELRQPVCCPCSCPYCPRHKGKGMGEQTHEP FT ETKILPDVSKL" FT gene 287. .>510 FT /gene="V1" FT CDS 287. .>510 FT /codon_start=1 FT /gene="V1" FT /product="coat protein" FT /note="CP" FT /db_xref="GOA:B4YT06" FT /db_xref="InterPro:IPR000263" FT /db_xref="UniProtKB/TrEMBL:B4YT06" FT /protein_id="ACF04185.1" FT /translation="MVKRPADIYISTPASKARRRLNFDSPYAVRAAVPIVRATKAREWV FT NRPMNRKPRFYRMYRSSDVPRGCEGPCKV" XX SQ Sequence 510 BP; 141 A; 123 C; 125 G; 121 T; 0 other; eu677429 Length: 510 23-MAR-2009 Type: N Check: 9436 .. 1 taatattacc ggatggccgc ggtgcctttt gtgtgggtcc agaaccaatg 51 aaattcgaga tacatggcta atttaatgca tggggaccaa taaatagact 101 tgcgcaccaa gattggatcc acaaacatgt gggatccatt attgcacgaa 151 tttcctgaaa gcgttcatgg tcttaggtgc atgctagctg taaaatatct 201 caaagagatt gaaaagacct attctccgga cacaatcgga tacgatcttg 251 ttcgtgacct aatctctgtc gtccgtgcga gaaactatgg tgaagcgtcc 301 agcagatatc tacatttcaa cgcccgcatc gaaagcacgc cgtcgtctga 351 acttcgacag cccgtatgct gtccgtgcag ctgtccctat tgtccgcgcc 401 acaaaggcaa gggaatgggt gaacagaccc atgaaccgga aaccaagatt 451 ttaccggatg tatcgaagct ctgacgtgcc caggggctgt gaagggccat 501 gcaaagtcca