Sequence of DPV Carnation Italian ringspot virus

Carnation Italian ringspot virus coat protein gene, complete cds.

ACC No: EU684163

Dated: 2008-06-04 | Length: 1161 | CRC: 894917259

                
ID   EU684163; SV 1; linear; genomic RNA; STD; VRL; 1161 BP.
XX
AC   EU684163;
XX
DT   04-JUN-2008 (Rel. 96, Created)
DT   04-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Carnation Italian ringspot virus coat protein gene, complete cds.
XX
KW   .
XX
OS   Carnation Italian ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1161
RA   Russo M., De Stradis A., Vovlas C.;
RT   "A disease of Limonium sinuatum caused by Carnation Italian ringspot
RT   virus";
RL   Unpublished.
XX
RN   [2]
RP   1-1161
RA   Russo M., Rubino L.;
RT   ;
RL   Submitted (30-APR-2008) to the EMBL/GenBank/DDBJ databases.
RL   Istituto di Virologia Vegetale, CNR, Via Amendola 165/A, Bari, BA 70126,
RL   Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1161
FT                   /organism="Carnation Italian ringspot virus"
FT                   /specific_host="Limonium sinuatum"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /collection_date="15-Mar-2008"
FT                   /virion
FT                   /note="acronym: CIRV"
FT                   /db_xref="taxon:39443"
FT   CDS             1. .1161
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="capsid protein"
FT                   /protein_id="ACD85085.1"
FT                   /translation="MTMDPRNSGTMVPQGGSKMSKMAKNAFQQGLQAGAAYLMSNPKGA
FT                   LKKGKDAWNYMTAGGVPSGIVHSGGMKGAIMAPVAVTRQLRGSKPKFSGRTSGSVTVSH
FT                   RELITQVNNSTQFVVNGGVTGNLRQVNPLNGTLFSWLPSIAANFDQYTFNSVTLHYVPL
FT                   CATTETGRVAMYFDKDSEDPEPADRVELANYATLKETAPWAEAMLRIPTDRIKRHNDDS
FT                   SVNDRKLIDLGQIGIATYGGSGTNPVGDVFISNSVTLHFPQPTAVGVQTRRLDLTSVLD
FT                   TNVGPSYTITSSTATVYTVAFRTVGTFMLLGAVRSTGSPVIGLSSANIAINSNTTLNTV
FT                   GTAFSYMTNVTVSALPASITFTVVGVITSSTSHAVRASRTNNADLI"
XX
SQ   Sequence 1161 BP; 323 A; 260 C; 294 G; 284 T; 0 other;

eu684163 Length: 1161  04-JUN-2008  Type: N  Check: 3828  ..

       1  atgacaatgg atccaagaaa ttcaggcaca atggtgcctc aaggcggcag
      51  caaaatgagc aagatggcga agaacgcatt tcaacaagga ttacaagcag
     101  gggctgctta tctgatgagc aaccctaagg gggcattgaa gaaggggaaa
     151  gacgcatgga attacatgac agcagggggt gtgccaagtg gtatagtaca
     201  ctcagggggc atgaaaggcg cgataatggc gcccgtggca gttaccagac
     251  agttaagggg gagtaaacct aaattctccg gaagaacatc tggttccgtg
     301  acagtgagtc atagagagct aattacgcaa gtgaacaact caacgcagtt
     351  tgtggttaat ggtggtgtta ctggtaacct taggcaagtt aatcccttga
     401  atgggacctt gttctcatgg ctgcctagca ttgccgctaa ctttgaccag
     451  tacacattca atagtgttac gttacattac gtacctttat gtgctactac
     501  cgagactggg cgagttgcaa tgtattttga caaagattcc gaggaccctg
     551  agcccgcgga cagagtagag cttgctaact atgctacatt gaaagaaact
     601  gcaccatggg ccgaggctat gttacgtata cctactgatc gtatcaaacg
     651  gcataatgat gacagcagcg taaatgatcg caaattgatt gacctgggac
     701  agataggtat tgcaacatat ggtggttcgg gcacaaaccc tgtcggggac
     751  gtgttcatat ctaacagtgt tactctacac ttcccacaac ccactgcagt
     801  cggcgtacag acacggcgtc ttgatctcac aagtgttttg gacacaaatg
     851  tcggacctag ttatactatc acgtccagta cggcgacagt gtacacagtt
     901  gcttttcgca ctgtgggcac ttttatgctg ttaggagctg tgaggtcaac
     951  tgggtcaccc gttatcggac tatccagtgc aaatattgct attaatagca
    1001  acaccacgtt gaacacagtc ggtactgctt tctcctacat gacgaacgtg
    1051  acggtgtcgg ctttgccggc atccatcacg ttcactgtag ttggagtgat
    1101  tacttcatca acttcacatg ccgtgagagc atcccgcact aataacgcag
    1151  acctgatata g