Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CT11 p25 gene, complete cds.

ACC No: EU693526

Dated: 2009-06-02 | Length: 672 | CRC: -945199924

                
ID   EU693526; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU693526;
XX
DT   02-JUN-2009 (Rel. 101, Created)
DT   02-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CT11 p25 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Xu M., Liu J., Zhou C.;
RT   ;
RL   Submitted (02-MAY-2008) to the EMBL/GenBank/DDBJ databases.
RL   Citrus Institute, Chinese Academy of Agricultural Sciences, Xiema,
RL   Chongqing, Beibei 800400712, P.R. China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="CT11"
FT                   /mol_type="genomic RNA"
FT                   /PCR_primers="fwd_seq: atggacgacgaaacaaag, rev_seq:
FT                   tcaacgtgtgttgaattt"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="p25"
FT                   /protein_id="ACH68790.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLRSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDTLYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 194 A; 125 C; 174 G; 179 T; 0 other;

eu693526 Length: 672  02-JUN-2009  Type: N  Check: 1249  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataaaga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcgaagtga tgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgcacta
     401  acgcccttcg agtctggggt agaagtaacg atacccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccagcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttggaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga