Sequence of DPV Armigeres subalbatus virus SaX06-AK20

Armigeres subalbatus virus SaX06-AK20, complete genome.

ACC No: EU715328

Dated: 2010-10-21 | Length: 7510 | CRC: 646080113

                
ID   EU715328; SV 1; linear; genomic RNA; STD; VRL; 7510 BP.
XX
AC   EU715328;
XX
DT   31-DEC-2009 (Rel. 103, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Armigeres subalbatus virus SaX06-AK20, complete genome.
XX
KW   .
XX
OS   Armigeres subalbatus virus SaX06-AK20
OC   Viruses; dsRNA viruses; Totiviridae.
XX
RN   [1]
RP   1-7510
RX   PUBMED; 20702653.
RA   Zhai Y., Attoui H., Mohd Jaafar F., Wang H.Q., Cao Y.X., Fan S.P.,
RA   Sun Y.X., Liu L.D., Mertens P.P., Meng W.S., Wang D., Liang G.;
RT   "Isolation and full-length sequence analysis of Armigeres subalbatus
RT   totivirus, the first totivirus isolate from mosquitoes representing a
RT   proposed novel genus (Artivirus) of the family Totiviridae";
RL   J. Gen. Virol. 91(PT 11):2836-2845(2010).
XX
RN   [2]
RP   1-7510
RA   Liang G., Zhai Y., Fu S.;
RT   ;
RL   Submitted (12-MAY-2008) to the EMBL/GenBank/DDBJ databases.
RL   State Key Laboratory for Infectious Disease Prevention and Control,
RL   Institute for Viral Disease Control and Prevention, Chinese Center for
RL   Disease Control and Prevention, #100 Ying Xin St., Xuanwu Dis., Beijing
RL   100052, P.R. China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7510
FT                   /organism="Armigeres subalbatus virus SaX06-AK20"
FT                   /host="Armigeres subalbatus"
FT                   /strain="SaX06-AK20"
FT                   /mol_type="genomic RNA"
FT                   /country="China:Shaanxi province"
FT                   /collection_date="2006"
FT                   /note="AsTV"
FT                   /db_xref="taxon:556524"
FT   CDS             472. .4914
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="ORF1; structural protein"
FT                   /db_xref="GOA:D2CSN1"
FT                   /db_xref="InterPro:IPR001159"
FT                   /db_xref="UniProtKB/TrEMBL:D2CSN1"
FT                   /protein_id="ACH85915.1"
FT                   /translation="MERHHNSNAQNEYPNEILSSAVQPNNNVSWNYHKIDGASAPLYPQ
FT                   PNGAETPDRLKVLRKYFTLSNVVLGAKIIIIGGVAFAGYKVAHGMYTWYEAISSPIAAL
FT                   ETTVSTEYHTLQTKYGYQWYDYFCPKCMLYKFATHSGNATTAASHHNHIMHALNGNGEQ
FT                   IHVIQIGNQIELTNTIAAMKFNVKLRSKNKVIVELVPLTAPSGDMATRNKTRHDQNNAI
FT                   AILNQIASQGNDKRLPLYHSFIKTGSDDRPRFDVSMVFKNVTYVGLGGATKHAAKTKAA
FT                   SAALIALHTSPELNGDQRATLSAWTRDLTKDGDVESNPGPRGLDLDFSYPNEETPPDMS
FT                   NFVPYTSYSTHTNLKPFNDVENYDRDSAFAEDYVADEYKAHLAKRVEYENATGNYFNYL
FT                   SSLLNLPTSNRFALLCVDDVDPEPCDDETETSTPEKQKPRPPKVARERKERPFVEKPVP
FT                   VKKIEKTEEEKKTDRMFALKRIAGQLKQTPEKVFLWVKRKMSPVFKTTILDLVFGLNWQ
FT                   EKTIMNQYEFAAYANLHDITDDELISTVINHDTKWASYSLQQKITLAKELNFSYVEAKS
FT                   LSHNKEMHSANGNILSNTLSDVEEHDKAQNIVKYNQATLPQYRGIEAQVYITNVAGDTN
FT                   PNFTRIFDQDRIRGNVVGAANNITNNCAVPLPMTCLIPRQVRPLVPGALVPALQRLRIT
FT                   ELNTAEYYLNPIIATDLSKMISDQVKNNQSSNWRRDNNSLSGFSTFDIATINTALLPKG
FT                   LTLESMLLKPDLLHSITSLRTNFTSINRSTFNAIDNNTVPSVGVSVTIGINNSPVFGED
FT                   CGGNNPVFPWLGNKGSVAFHLTLASVPIDQRDDAIVMPPGLLQASYDASEAVAMFVMSW
FT                   AEWPFGIYTATRPTTDTAGGNNQNQVFVPTQSLTRVAGRRTLNIVLPKRFAEAAPTSGP
FT                   QANAQATLRPTAGPVAAAGAPPILAGQVLDINFVGGALIAYPLTDYLYTWATQFDATPI
FT                   RQYIGRLGVLMGVKDTLLVAHEMNIALCQQYPKMVTGAGGVASPAPNSIPQFDLCYCNH
FT                   TQVTTSVANFPLAADVRADYRIFETNPATWNKVCLGLATAPNLTPDEPVDIPYHLGNPS
FT                   NAFWERLESVPMAASWALYYNLRGLTTLAWNNAYTNANSVWAQRMARETFCTTHVTGTI
FT                   VPARYGRIPHDIMKSVYGRAPKTTQTSKGGTLIDISHFERWLPGAPFASVYTAAGVEVT
FT                   GLTPTILADIWIQYPADNLPILAATFPPPFHRDSVQGFDSRNGLAIHRNMNNDLVSPYM
FT                   EPDPRAFFDVNKGPVMNDFAVWNSRLWFTHPNRQILDYSGGAIAEVIPAAGTYPLGRGI
FT                   PLLTGENVPPELANASTICIPRFSNAGQRIFLYVTQAQSVQLVGACNRSNRLMRSAWLL
FT                   NDVYKAPDVQQWGRDEEDEFDTITKSYFLDVTTAGVDNATNQIPATLVNTNEQAVDVSQ
FT                   LPSSANPSTTMEQPTSVAI"
FT   CDS             5145. .7430
FT                   /codon_start=1
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="ORF2; deduced RNA-dependent RNA polymerase;
FT                   nonstructural protein"
FT                   /db_xref="GOA:D2CSN2"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="UniProtKB/TrEMBL:D2CSN2"
FT                   /protein_id="ACH85916.1"
FT                   /translation="MKDILCVVSQELKEEMKYYQHLDNILFTNIMIYGHIHGPSTIREL
FT                   RELGMFNDFETFVTMAGKISGHFKRYPICKDETKQRLCEIQCLTGYLQNDPPGWDFEKE
FT                   FVSLAEGGYEHGLVGEDWPARFKELNDKVMTRQPMPDFISFEDFIRDGLWITAGSSSIG
FT                   KVEWTKTDDKGKFKARKNMLTELYTDEDLIEIVNNWDGILRSRVFTKDELSKRRLAVAS
FT                   NIEAYLSEAWILHLFGHGFKNYEYITLDESPKRQHERTSKLINLLRNGSFCLPFDFKGF
FT                   DHQPQIKAEVQVILQKIVDHVRTKVPKDKLATFNSIAVRMVESYAKGEIINPMTMEVLI
FT                   QIGGIPSGVRPTSLIGNVWNGDMTTYARELTKLMMRRDEIEEIGIKGDDTYIASKNPVA
FT                   LIIFRLAYAAVNAIGLDSKFGISQNICEFLRNEISINGCQGWSNRAIPSLSQRKPWNAQ
FT                   PWSPSSEVATVANNIYLLERRLKRSTPQLHQANKIKWSKYTNQSYHWLHLPVRLGGFGL
FT                   YPFEGWEPNGKLPLVAKPFITVNNLKISREYVPWAKLTPEQNILYAQEDFNSKIATDDI
FT                   PGPQKYYSRDFVNILRTKTFSWTKEPTIIRIFPPKVQRPPVAEHVWWPRDRFVNQKSLD
FT                   PTMPIFAEFIRQHQTLKRASGRMNIKVEPLPALAKKWYPHLWSSVEYFEANGWHRTDAI
FT                   NLAIGNIPTEPTKILHPSLTAFVKESVKRNNFRYWKGRRNIALNLYTITTLAVHEIQAT
FT                   GGKHLYAY"
XX
SQ   Sequence 7510 BP; 2239 A; 1815 C; 1672 G; 1784 T; 0 other;

eu715328 Length: 7510  21-OCT-2010  Type: N  Check: 702  ..

       1  gaagtagaag aggagacctg atcttctact tcacaagatc atccggattt
      51  ccttgtaatc catcaatcag gcacaaacaa gcttactttg atctgttttt
     101  aaagagggta cagatgactt cgctctcctc gttggacggg agagactctg
     151  acctattttg acataactat atctttgatt ttgtatttat cacttgcctc
     201  tagtcctagg gatgtcgtgt gttggtcatg acctgtcgta gcacgaatac
     251  ttatgatgga tgtaggaggg gaaagcatag atgcagatga ttaactactg
     301  gtgtgatgag ttggtgatac cctgccagta gggatagaca ttattaatga
     351  atagcgagga tggcatccga ggccacttaa tctgcagtga atgtttgtgg
     401  acgtgtgtta ttgatgctgg aaagcatgga aatttgagaa ccagggtgac
     451  ttctggaaag acagacggct gatggaaaga catcacaata gcaatgctca
     501  aaatgaatac ccaaacgaaa ttctctcgag cgcagtccaa cccaacaaca
     551  acgtttcgtg gaactaccac aagatagatg gagctagcgc tcctctatac
     601  ccgcaaccaa acggtgccga gacccctgac cgtttgaagg ttctgcggaa
     651  gtacttcaca ctatcaaatg tcgtgttagg ggcaaaaatc atcattatcg
     701  gcggagttgc ttttgccgga tacaaagttg cacacggaat gtatacctgg
     751  tatgaggcaa tctcgtctcc gatagcagca cttgaaacta cagtatcaac
     801  cgaataccac actctccaaa caaaatatgg ctaccaatgg tatgactatt
     851  tctgcccaaa atgcatgctt tacaaatttg ccactcatag tggaaacgct
     901  accacagcag cttctcacca caaccatatt atgcacgcgc tcaatggcaa
     951  tggagaacaa attcacgtca tacagatagg aaaccaaatc gaacttacaa
    1001  acacgattgc cgccatgaaa ttcaacgtca aactcaggtc taagaacaaa
    1051  gtgattgttg aacttgtccc acttacagct ccttctggcg atatggctac
    1101  ccgaaacaaa acacggcatg accagaataa cgccatcgct atactgaacc
    1151  aaatcgcatc ccaaggcaat gacaagcggc taccactgta tcacagtttt
    1201  atcaaaacag gatcggatga caggccgagg ttcgacgtgt cgatggtatt
    1251  caaaaatgta acctacgtag ggctgggggg tgctacgaag catgcagcta
    1301  agactaaagc agcgtctgct gccctcatag cattgcatac atcacccgag
    1351  ctcaacggcg accaaagggc gacgttaagc gcctggacac gcgatttgac
    1401  caaagacggc gacgttgaga gcaatcctgg acctagagga ttggatttgg
    1451  atttttccta cccaaatgaa gagactccac ctgatatgtc caacttcgta
    1501  ccatacacga gttactccac acatactaac ttaaaacctt tcaatgacgt
    1551  ggagaactac gaccgagact ctgctttcgc tgaggattac gttgctgacg
    1601  agtacaaggc tcatcttgcc aagcgcgtgg aatacgagaa tgcgacaggc
    1651  aactacttta actatttatc tagtctgctg aacttaccaa cctccaaccg
    1701  attcgccctc ctgtgtgttg atgacgtaga cccggagcca tgtgatgacg
    1751  aaacagaaac aagcacacca gagaagcaaa aacctcgacc tccaaaagtt
    1801  gctagggagc ggaaggaaag gccatttgtc gagaagcctg ttcctgtcaa
    1851  gaagatcgaa aagacagaag aagaaaagaa gactgatcga atgttcgcgc
    1901  tcaaaagaat agctggccaa ctgaaacaga cccccgaaaa agtgtttctc
    1951  tgggtaaaaa gaaaaatgag tcccgtgttc aagacaacaa tattagatct
    2001  ggtatttggt ctgaactggc aggagaaaac catcatgaac cagtatgaat
    2051  ttgcggccta cgccaaccta cacgacatta ctgacgatga gttaatctca
    2101  acagtcatca atcacgacac gaagtgggcc agctattccc tccaacaaaa
    2151  gatcacattg gctaaagaac taaacttttc ctacgtcgaa gccaaatccc
    2201  tctcccataa caaggagatg cactcagcta acggcaacat cctgtccaac
    2251  accttatccg atgtcgagga acatgacaaa gcccaaaata ttgtcaaata
    2301  taatcaagcc acactaccac agtaccgcgg aatcgaagca caagtgtata
    2351  taacgaacgt ggctggtgac accaacccta attttacgcg aatttttgat
    2401  caggaccgga tccgtggtaa tgtcgttgga gcagctaata atatcacaaa
    2451  taattgcgct gtcccccttc caatgacttg cctcattcca cgccaagtta
    2501  gacctctggt accgggcgcg ctagtcccag cgctgcaaag gttgcgtatt
    2551  actgagttaa acaccgctga atattatttg aatcctatca tagcaaccga
    2601  cttatccaaa atgatttccg atcaggtcaa gaataatcaa agctccaact
    2651  ggcgccggga taacaactct ctatcgggat tttcgacctt tgacatcgca
    2701  accatcaaca ctgccttgct acctaaaggc ttgactttag aatccatgct
    2751  gttgaagcct gacttgttgc attccataac ctcactaagg actaacttca
    2801  catctattaa ccgttcaacc ttcaatgcta ttgacaacaa taccgttcca
    2851  tctgtcggag tcagcgtaac tatcgggatc aacaactccc ctgtatttgg
    2901  agaagactgc ggaggtaaca accctgtgtt tccatggttg ggaaacaagg
    2951  gcagtgtcgc atttcatctt accttggcat ccgttccaat tgatcaacgt
    3001  gatgatgcaa tcgtcatgcc tcctggcttg ttacaagcgt cttatgatgc
    3051  gagcgaagcg gtagcaatgt tcgttatgtc atgggcggag tggccctttg
    3101  gcatctacac tgcaactaga ccaacgaccg acaccgccgg agggaacaat
    3151  caaaatcagg tgtttgtccc cactcaaagt ttgacacgcg tagcagggcg
    3201  gaggacactc aacatcgtgc tacccaagcg gttcgctgag gccgctccca
    3251  catctggacc ccaggcaaac gctcaagcca ctcttcgacc aactgctggg
    3301  cccgttgctg cggccggtgc accaccaatt ttggctgggc aagtgcttga
    3351  catcaatttc gttggcggag cactaatagc ttaccctctt accgactacc
    3401  tgtacacatg ggctactcaa ttcgacgcaa caccaattag acaatacatt
    3451  ggcagactgg gagtgttgat gggagtgaag gatacactgc tcgtagctca
    3501  tgagatgaac attgctctgt gtcagcaata ccctaagatg gtgactggag
    3551  ccggaggtgt tgcctcgccc gctcctaatt ccataccaca gtttgatttg
    3601  tgctactgca accacactca ggttaccacc tctgtagcta actttccttt
    3651  ggctgctgat gttcgagctg actaccggat ctttgaaact aatcctgcaa
    3701  cttggaacaa ggtgtgcttg ggtctggcaa cggcacccaa cctaacacct
    3751  gatgagccgg tagatattcc ttaccacctg ggcaatccct cgaatgcatt
    3801  ctgggaacgg cttgagtctg taccaatggc cgcttcttgg gcactctact
    3851  ataatctgcg cggtctcacc accttggcgt ggaataatgc gtatactaat
    3901  gccaacagcg tgtgggctca aaggatggct agggaaacat tctgcacaac
    3951  tcatgtcaca ggaaccatag tgccagccag gtacggcaga ataccgcatg
    4001  acataatgaa gtctgtatac ggccgagctc caaaaactac tcaaaccagc
    4051  aagggcggca cactcatcga tatttctcac ttcgaacgct ggttaccggg
    4101  cgccccattc gcgtcagtat acacagccgc aggtgtggag gtgactgggc
    4151  taacaccgac aatcctggct gatatctgga ttcagtatcc agctgacaat
    4201  ttgcccatct tggctgcaac tttcccacct ccatttcacc gggattctgt
    4251  ccaagggttt gactcacgaa acgggctcgc aatccacagg aacatgaaca
    4301  acgatctggt atctccgtat atggagccag accccagagc cttcttcgac
    4351  gtgaacaagg gacctgtcat gaacgatttc gcagtatgga attcaagact
    4401  gtggtttacc catcctaaca gacaaatcct tgactattca ggaggggcta
    4451  tcgctgaagt gattccggcc gcgggtactt accccttggg acgcggcatt
    4501  ccactgttga caggggagaa cgtccctcct gagcttgcaa atgcttcaac
    4551  aatctgcata cctcggttct cgaacgctgg acagcggata tttttatatg
    4601  tcacacaggc acagtccgtc cagttggtgg gggcatgcaa caggtctaat
    4651  cgactaatgc gcagtgcttg gctgcttaac gatgtgtaca aggcacccga
    4701  tgttcaacaa tggggcagag atgaagagga cgaatttgac actattacca
    4751  agagctattt tttagatgta acgaccgcag gtgtcgacaa tgctacgaat
    4801  cagatacccg cgacattagt aaatacgaac gagcaagcgg tggatgtatc
    4851  acagctgccc tcttcggcaa atccatcgac tactatggaa caaccgacat
    4901  cggtcgcaat ctagaagaaa tactcaaatt aaaggacaag cctttgacag
    4951  ccaggctgca agaaagactc acttctttaa ccgacggatt ggtcaagttt
    5001  gacgagatta attggacagg agcattacag tggattaaga acaatttgcc
    5051  cgcagtgaac acaacaatta agggtgagtt agaaccatcg gacgatacaa
    5101  tagaccctcg tgtgaaagga gatctagcca tcagacggct aaggatgaaa
    5151  gacattctgt gtgtcgtatc tcaagagctt aaggaggaga tgaaatatta
    5201  ccaacacctt gacaacattc tgtttaccaa catcatgatt tatggtcaca
    5251  tccatggacc ctcaaccatt cgagaattgc gagagctggg catgtttaac
    5301  gactttgaaa cgtttgtcac aatggctggg aaaatttcag gacatttcaa
    5351  aagatacccc atttgcaagg acgaaacaaa acaaaggttg tgcgagattc
    5401  aatgtcttac tgggtaccta cagaacgacc cacccggttg ggatttcgaa
    5451  aaagagtttg tatcactagc agagggtgga tatgaacatg gtttggtggg
    5501  agaagactgg cctgctcgat ttaaggaatt gaacgataaa gtgatgacac
    5551  gacagccaat gcctgacttc atatcgtttg aggacttcat tcgtgacgga
    5601  ctgtggatta ctgccggatc atcgtcaatt gggaaagtgg aatggaccaa
    5651  aacggacgac aagggtaagt tcaaggcccg aaagaacatg ctgactgaat
    5701  tgtacactga cgaggatctg attgagatcg tgaacaactg ggatgggatt
    5751  ttgagatcaa gagtgtttac gaaggatgaa ttgtctaagc gacgtcttgc
    5801  tgttgcatcg aacatcgagg cttacctgtc agaagcctgg atcctacatc
    5851  tatttgggca cggttttaaa aactacgaat acatcacctt agacgaatcg
    5901  cccaaacgtc aacatgagcg aacatccaaa ctaattaact tgctgagaaa
    5951  tggttctttc tgcctaccat tcgatttcaa agggtttgat caccaaccac
    6001  agattaaagc tgaagttcaa gttattttgc aaaaaattgt cgatcatgtg
    6051  cgaaccaaag ttccaaagga taagctggcc actttcaata gtatagctgt
    6101  gcggatggtt gaaagctacg caaaaggaga aattatcaat ccaatgacaa
    6151  tggaagtgct gatacaaata gggggaatac cgtctggtgt gcgtccaact
    6201  tcattgattg gcaatgtttg gaatggagac atgaccacct acgctcgcga
    6251  gttgaccaag ctcatgatgc ggcgtgacga gatagaagaa attggcatca
    6301  aaggcgacga tacatacata gcatcaaaga accccgtcgc tttgataata
    6351  ttcagactgg cttatgcagc agtcaatgcc attggtttag attcaaaatt
    6401  tggaatatca caaaacatct gcgaattttt gagaaacgag atatcaatta
    6451  acggttgcca aggatggtcc aatcgagcta taccatcatt atctcaaaga
    6501  aaaccatgga atgcacaacc ttggtcaccc tcttccgaag ttgcgaccgt
    6551  cgctaataat atttatttac ttgaacgtcg actgaaacgc agcacaccac
    6601  aacttcatca agccaacaaa atcaaatgga gcaaatatac caatcaatca
    6651  tatcattggc ttcatcttcc ggttcgactc ggaggttttg gactgtatcc
    6701  gtttgagggg tgggaaccta atggcaagct accacttgtc gcgaaaccct
    6751  tcataacggt gaacaatctc aagatctccc gagagtacgt accttgggca
    6801  aagctgacac cagaacagaa tatcttgtac gctcaggaag atttcaacag
    6851  caaaatagcc acagacgaca tcccaggtcc gcaaaaatac tactcgcgtg
    6901  atttcgtgaa cattctgcgt actaaaacat tctcatggac caaagaacca
    6951  accataattc ggatttttcc accgaaagtg caacgtcctc cggtcgctga
    7001  acacgtttgg tggcctaggg acagatttgt caatcaaaaa tctctcgatc
    7051  caacaatgcc tatatttgcc gagtttatca gacaacatca aacactcaaa
    7101  cgagcatcgg gtcgtatgaa catcaaggtc gagccgcttc ccgcacttgc
    7151  taaaaagtgg tatccacact tgtggtcaag tgtcgaatat tttgaagcga
    7201  atggctggca tagaaccgac gcaatcaatc tggcaatcgg caacatacca
    7251  actgagccga caaaaatatt acacccttcg ctgaccgctt ttgtgaagga
    7301  aagtgtcaag cgaaacaact ttcggtattg gaaaggtcga cgcaacattg
    7351  cgctaaattt gtacactata acaacactag cagtacacga aatacaggca
    7401  acaggcggca aacatctgta cgcctactag gtaagactca tgaccatcag
    7451  tgagcaccat actagagaac cctataacat cgatatgcag ttgcatactc
    7501  ttctagccta