Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate WA-7H1 major coat protein gene, complete cds.

ACC No: EU760836

Dated: 2011-07-14 | Length: 597 | CRC: -1912502620

                
ID   EU760836; SV 1; linear; viral cRNA; STD; VRL; 597 BP.
XX
AC   EU760836;
XX
DT   01-MAY-2009 (Rel. 100, Created)
DT   14-JUL-2011 (Rel. 109, Last updated, Version 2)
XX
DE   Grapevine leafroll-associated virus 2 isolate WA-7H1 major coat protein
DE   gene, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RX   DOI; 10.1094/PHYTO-100-7-0698.
RX   PUBMED; 20528188.
RA   Jarugula S., Alabi O.J., Martin R.R., Naidu R.A.;
RT   "Genetic variability of natural populations of Grapevine
RT   leafroll-associated virus 2 in Pacific Northwest vineyards";
RL   Phytopathology 100(7):698-707(2010).
XX
RN   [2]
RP   1-597
RA   Jarugula S., Naidu R.A.;
RT   ;
RL   Submitted (25-APR-2008) to the INSDC.
RL   Plant Pathology, Washington State University, Irrigated Agriculture
RL   Research and Extension Center, Prosser, WA 99350, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="Vitis vinifera; Cabernet Sauvignon cultivar"
FT                   /isolate="WA-7H1"
FT                   /mol_type="viral cRNA"
FT                   /country="USA"
FT                   /proviral
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /db_xref="GOA:O39857"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:O39857"
FT                   /protein_id="ACE82547.1"
FT                   /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 164 A; 121 C; 157 G; 155 T; 0 other;

eu760836 Length: 597  14-JUL-2011  Type: N  Check: 152  ..

       1  atggagttga tgtccgacag caaccttagc aacctggtga taaccgacgc
      51  ctctagtcta aatggtgtcg acaagaagct tttatctgct gaagttgtaa
     101  aaatgttggt gcagaaaggg gctcctaacg agggtataga agtggtgttc
     151  ggtctactcc tttacgcact cgcggcaaga accacgtctc ctaaggttca
     201  gcgcgcagat tcagacgtta tattttcaaa tagtttcgga gagaggaatg
     251  tggtagtaac agagggtgac cttaagaagg tactcgacgg gtgtgcgcct
     301  ctcactaggt tcactaataa acttagaacg ttcggtcgta ctttcactga
     351  ggcttacgtt gacttttgta tcgcgtataa gcacaaatta ccccaactca
     401  acgccgcggc ggaattgggg attccagctg aagattcgta cttagctgca
     451  gattttctgg gtacttgccc gaagctctct gaattacagc aaagtaggaa
     501  gatgttcgcg agtatgtacg ctctaaaaac tgaaggtgga gtggtaaata
     551  caccagtgag caatctgcgt cagctaggta gaagggaagt tatgtaa