Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate WA-MCU2 major coat protein gene, complete cds.

ACC No: EU760840

Dated: 2011-07-14 | Length: 597 | CRC: 1880191328

                
ID   EU760840; SV 1; linear; viral cRNA; STD; VRL; 597 BP.
XX
AC   EU760840;
XX
DT   01-MAY-2009 (Rel. 100, Created)
DT   14-JUL-2011 (Rel. 109, Last updated, Version 2)
XX
DE   Grapevine leafroll-associated virus 2 isolate WA-MCU2 major coat protein
DE   gene, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RX   DOI; 10.1094/PHYTO-100-7-0698.
RX   PUBMED; 20528188.
RA   Jarugula S., Alabi O.J., Martin R.R., Naidu R.A.;
RT   "Genetic variability of natural populations of Grapevine
RT   leafroll-associated virus 2 in Pacific Northwest vineyards";
RL   Phytopathology 100(7):698-707(2010).
XX
RN   [2]
RP   1-597
RA   Jarugula S., Naidu R.A.;
RT   ;
RL   Submitted (25-APR-2008) to the INSDC.
RL   Plant Pathology, Washington State University, Irrigated Agriculture
RL   Research and Extension Center, Prosser, WA 99350, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="Vitis vinifera; Sangiovese cultivar"
FT                   /isolate="WA-MCU2"
FT                   /mol_type="viral cRNA"
FT                   /country="USA"
FT                   /proviral
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /db_xref="GOA:C3SAG2"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:C3SAG2"
FT                   /protein_id="ACE82551.1"
FT                   /translation="MELMSDENLNNLVIIDATSLNGVDKKLLSAEVIKMLVQKGAPSDG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDLIFSNSFGERNIAVTEGDLRKILDGCAPLTRF
FT                   TNKLRTFGRTFTDAYIDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 180 A; 125 C; 142 G; 150 T; 0 other;

eu760840 Length: 597  14-JUL-2011  Type: N  Check: 4894  ..

       1  atggagttga tgtctgacga gaaccttaac aatctggtga taatcgacgc
      51  cactagtcta aacggtgtcg ataagaaact tctatctgca gaagttataa
     101  aaatgttggt gcaaaagggt gctcctagcg acggtataga agtggttttt
     151  ggtctacttc tttacgcgct cgctgcaaga actacgtcgc ctaaagttca
     201  gcgtgctgac tcagacttaa tattctcaaa cagcttcgga gagaggaata
     251  tagcagtgac ggagggtgat cttagaaaga tactcgacgg gtgcgcacct
     301  cttactaggt tcactaacaa acttagaaca ttcggtcgca ctttcactga
     351  tgcctacatc gacttttgta tcgcgtataa gcacaaatta cctcaactca
     401  atgccgcagc agaattagga ataccagctg aagattcata cttagctgca
     451  gattttctag gcacttgccc gaagctctca gaactgcagc aaagtagaaa
     501  gatgttcgcg agtatgtacg ctctaaaaac agagggtgga gtggtaaaca
     551  cgccagtgag caacctacgt cagttaggta gaagggaagt catgtaa