Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate WA-HHA1 major coat protein gene, complete cds.

ACC No: EU760845

Dated: 2011-07-14 | Length: 597 | CRC: 1985983689

                
ID   EU760845; SV 1; linear; viral cRNA; STD; VRL; 597 BP.
XX
AC   EU760845;
XX
DT   01-MAY-2009 (Rel. 100, Created)
DT   14-JUL-2011 (Rel. 109, Last updated, Version 2)
XX
DE   Grapevine leafroll-associated virus 2 isolate WA-HHA1 major coat protein
DE   gene, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RX   DOI; 10.1094/PHYTO-100-7-0698.
RX   PUBMED; 20528188.
RA   Jarugula S., Alabi O.J., Martin R.R., Naidu R.A.;
RT   "Genetic variability of natural populations of Grapevine
RT   leafroll-associated virus 2 in Pacific Northwest vineyards";
RL   Phytopathology 100(7):698-707(2010).
XX
RN   [2]
RP   1-597
RA   Jarugula S., Naidu R.A.;
RT   ;
RL   Submitted (25-APR-2008) to the INSDC.
RL   Plant Pathology, Washington State University, Irrigated Agriculture
RL   Research and Extension Center, Prosser, WA 99350, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="Vitis vinifera; Cabernet Sauvignon cultivar"
FT                   /isolate="WA-HHA1"
FT                   /mol_type="viral cRNA"
FT                   /country="USA"
FT                   /proviral
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /db_xref="GOA:A7LNV4"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:A7LNV4"
FT                   /protein_id="ACE82556.1"
FT                   /translation="MELMSDENLNNLVITDATSLNGVDKKLLAAEVIKMLVQKGAPNDG
FT                   IEVIFGLLLYALAARTTSPKVQRADSDLIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYIDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 176 A; 123 C; 147 G; 151 T; 0 other;

eu760845 Length: 597  14-JUL-2011  Type: N  Check: 7378  ..

       1  atggagttga tgtctgacga gaaccttaac aatctggtga taactgacgc
      51  cactagtcta aatggtgtcg ataagaaact tctagctgcg gaagttataa
     101  aaatgttggt gcaaaagggt gctcctaacg acggtataga agtgatcttc
     151  ggtctacttc tttacgcgct cgcagcaaga actacgtcgc ctaaggttca
     201  gcgcgccgat tctgacttaa tattctcaaa cagtttcgga gagagaaacg
     251  tagtggtgac ggagggtgac cttaaaaaag ttctcgacgg gtgtgcgcct
     301  ctcactaggt tcactaacaa acttagaaca ttcggtcgca ctttcactga
     351  ggcctacatc gacttttgta ttgcgtataa gcataagtta cctcaactca
     401  atgccgcagc agaattaggg ataccagctg aagattcata cttagctgca
     451  gattttctag gcacttgccc gaagctctca gaactgcaac aaagtagaaa
     501  gatgttcgcg agtatgtacg ctctaaaaac agaaggtgga gtggtgaata
     551  caccagtgag caatctgcgt cagctgggta gaagggaagt tatgtaa