Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 strain Red Globe isolate WA-Chot2 major coat protein gene, complete cds.

ACC No: EU760851

Dated: 2011-07-14 | Length: 597 | CRC: -341268330

                
ID   EU760851; SV 1; linear; viral cRNA; STD; VRL; 597 BP.
XX
AC   EU760851;
XX
DT   01-MAY-2009 (Rel. 100, Created)
DT   14-JUL-2011 (Rel. 109, Last updated, Version 2)
XX
DE   Grapevine leafroll-associated virus 2 strain Red Globe isolate WA-Chot2
DE   major coat protein gene, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RX   DOI; 10.1094/PHYTO-100-7-0698.
RX   PUBMED; 20528188.
RA   Jarugula S., Alabi O.J., Martin R.R., Naidu R.A.;
RT   "Genetic variability of natural populations of Grapevine
RT   leafroll-associated virus 2 in Pacific Northwest vineyards";
RL   Phytopathology 100(7):698-707(2010).
XX
RN   [2]
RP   1-597
RA   Jarugula S., Naidu R.A.;
RT   ;
RL   Submitted (25-APR-2008) to the INSDC.
RL   Plant Pathology, Washington State University, Irrigated Agriculture
RL   Research and Extension Center, Prosser, WA 99350, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="Vitis vinifera; Chardonnay cultivar"
FT                   /strain="Red Globe"
FT                   /isolate="WA-Chot2"
FT                   /mol_type="viral cRNA"
FT                   /country="USA"
FT                   /proviral
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /db_xref="GOA:C3SAH4"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:C3SAH4"
FT                   /protein_id="ACE82562.1"
FT                   /translation="MDLMSDDNLSGLVITDASSLNGVDKKLLSAEVIKMLVQKGAPSEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDIIFQNTYGDKTVVVTEGDLKKVLEGCAPLNRF
FT                   TNKPRTFGRTFTEAYIDFCMAYKHKLPQLNAAAELGIPAEDSYLAADFLGACPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 164 A; 123 C; 157 G; 153 T; 0 other;

eu760851 Length: 597  14-JUL-2011  Type: N  Check: 8899  ..

       1  atggacttga tgtccgatga taacttgagc ggtctcgtca taaccgacgc
      51  ttctagtttg aatggtgtcg ataagaaact gctgtctgcg gaggtcataa
     101  aaatgcttgt gcagaagggg gcgcccagcg aaggtattga agtagtcttt
     151  gggctactgc tctacgctct cgcagcgaga accacatcgc ccaaagttca
     201  gagggctgat tctgatataa tctttcaaaa cacttacggt gacaagactg
     251  ttgtcgtgac agaaggtgat ctcaagaaag tgcttgaagg gtgcgcacct
     301  cttaatagat tcactaacaa gccgcgaact ttcggccgca cgtttacgga
     351  ggcgtatatt gatttctgca tggcttacaa gcataagttg cctcagctca
     401  acgcggccgc agaattgggg ataccagcag aagattcgta cctagctgcg
     451  gactttttag gtgcttgccc gaaactctct gaattacaac aaagtagaaa
     501  aatgtttgca agtatgtacg ctttgaagac tgagggcgga gtagtaaata
     551  cgcccgttag taatttgcgc caattaggta ggagagaagt tatgtga