Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 strain Red Globe isolate WA-BV4 major coat protein gene, complete cds.

ACC No: EU760853

Dated: 2011-07-14 | Length: 597 | CRC: -1796063989

                
ID   EU760853; SV 1; linear; viral cRNA; STD; VRL; 597 BP.
XX
AC   EU760853;
XX
DT   01-MAY-2009 (Rel. 100, Created)
DT   14-JUL-2011 (Rel. 109, Last updated, Version 2)
XX
DE   Grapevine leafroll-associated virus 2 strain Red Globe isolate WA-BV4 major
DE   coat protein gene, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RX   DOI; 10.1094/PHYTO-100-7-0698.
RX   PUBMED; 20528188.
RA   Jarugula S., Alabi O.J., Martin R.R., Naidu R.A.;
RT   "Genetic variability of natural populations of Grapevine
RT   leafroll-associated virus 2 in Pacific Northwest vineyards";
RL   Phytopathology 100(7):698-707(2010).
XX
RN   [2]
RP   1-597
RA   Jarugula S., Naidu R.A.;
RT   ;
RL   Submitted (25-APR-2008) to the INSDC.
RL   Plant Pathology, Washington State University, Irrigated Agriculture
RL   Research and Extension Center, Prosser, WA 99350, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="Vitis vinifera; Pinot Noir cultivar"
FT                   /strain="Red Globe"
FT                   /isolate="WA-BV4"
FT                   /mol_type="viral cRNA"
FT                   /country="USA"
FT                   /proviral
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /db_xref="GOA:C3SAH6"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:C3SAH6"
FT                   /protein_id="ACE82564.1"
FT                   /translation="MELMSDDNLSGLVITDASSLNGVDKKLLSAEVKKMLVQKGAPSEG
FT                   IEIVFGLLLYALAARTTSPKVQRADSDIIFQNTYGDKTVVVTEGDLKKVLEGCAPLNRF
FT                   TNKPRTFGRTFTEEYIDFCLAYKHKMPQLNAAAELGIPAEDSYLAADFLGACPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 167 A; 122 C; 157 G; 151 T; 0 other;

eu760853 Length: 597  14-JUL-2011  Type: N  Check: 7136  ..

       1  atggagttga tgtccgatga taacttgagc ggtctcgtca taaccgacgc
      51  ttctagtttg aatggtgtcg ataagaaact gctgtctgcg gaggtcaaaa
     101  aaatgcttgt gcagaagggg gcgcccagcg aaggtattga aatagtcttt
     151  gggctactgc tctacgctct cgcagcgaga accacatcgc ccaaagttca
     201  gagggctgat tctgatataa tctttcaaaa cacttacggt gacaagactg
     251  ttgtcgtgac agaaggtgat ctcaagaaag tgcttgaagg gtgcgcacct
     301  cttaatagat tcactaacaa gccgcgaact ttcggccgca cgtttacgga
     351  ggagtatatt gatttctgcc tggcttacaa gcataagatg cctcagctca
     401  acgcggccgc agaattgggg ataccagcag aagattcgta cctagctgcg
     451  gactttttag gtgcttgccc gaaactctct gaattacaac aaagtagaaa
     501  aatgtttgca agtatgtacg ctttgaagac tgagggcgga gtagtaaata
     551  cgcccgttag taatttgcgc caattaggta ggagagaagt tatgtga