Sequence of DPV Pelargonium line pattern virus

Pelargonium line pattern virus isolate SPA4 from Spain, complete genome.

ACC No: EU849616

Dated: 2011-01-28 | Length: 3883 | CRC: 360690273

                
ID   EU849616; SV 1; linear; genomic RNA; STD; VRL; 3883 BP.
XX
AC   EU849616;
XX
DT   01-JUL-2009 (Rel. 101, Created)
DT   28-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Pelargonium line pattern virus isolate SPA4 from Spain, complete genome.
XX
KW   .
XX
OS   Pelargonium line pattern virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-3883
RX   PUBMED; 20979982.
RA   Castano A., Ruiz L., Elena S.F., Hernandez C.;
RT   "Population differentiation and selective constraints in Pelargonium line
RT   pattern virus";
RL   Virus Res. 155(1):274-282(2011).
XX
RN   [2]
RP   1-3883
RA   Castano A., Ruiz L., Hernandez C.;
RT   "Sequence variability of distinct isolates of Pelargonium line pattern
RT   virus";
RL   Unpublished.
XX
RN   [3]
RP   1-3883
RA   Castano A., Ruiz L., Hernandez C.;
RT   ;
RL   Submitted (24-JUN-2008) to the EMBL/GenBank/DDBJ databases.
RL   Instituto de Biologia Molecular y Celular de plantas, UPV-CPI, Ing. Fausto
RL   Elio s/n, Valencia, Valencia 46033, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3883
FT                   /organism="Pelargonium line pattern virus"
FT                   /host="Pelargonium zonale"
FT                   /lab_host="Chenopodium quinoa"
FT                   /isolate="SPA4"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain"
FT                   /db_xref="taxon:167019"
FT   5'UTR           1. .6
FT   gene            7. .2304
FT                   /gene="p87"
FT   CDS             7. .2304
FT                   /codon_start=1
FT                   /transl_except=(pos:727. .729,aa:OTHER)
FT                   /gene="p87"
FT                   /product="p87"
FT                   /note="RNA-dependent RNA polymerase; p87 is a putative
FT                   readtrough protein of p27"
FT                   /db_xref="GOA:C6F396"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:C6F396"
FT                   /protein_id="ACJ24784.1"
FT                   /translation="MAHYFGEALQLGLFAAKASCWASKELALLGPNLAWIATRPLRNDA
FT                   NAILERIGVHGLAKIPCNFDSDELTIANDCIVKSDRNLEDESIVVEEIEEGEEKKKSKK
FT                   VTRRRVKTKPTFAAVLAADAKNYYGCLPSATRANELSVMKYLVSKCQEHKLTITQTREV
FT                   SAMAFALTFTPDENDKLIYKYLNSTEVFERRVDYAKARGVDKCWFELLKRPWHARAWRR
FT                   VVGRIFGMPEQQAFEFVKXGCLMDTCGVDTKVYRGEHHWVKEFRGAANPKPRRLYKISG
FT                   VSPEVRWGVHNNSFVNLRRGLMERVFYVERCGKLLPCPSPEAGLFKRLFNKVGRRVIRF
FT                   CGHHSPIPRASYPGMFQGRKRTIYENAVRSLVDRPYNIRDSYLKTFVKFEKLDFSKKPD
FT                   PAPRVIQPRHPRYNVELGRYLKPFEHFCYKALDKLWGGPTVMKGYTVEEMGGIIKDCWL
FT                   QFQKPVAIGFDMSRFDQHVSVDALKFEHSIYKACFSKDGNLATLLGHQISNRGSAYAND
FT                   GYLRYRVEGKRMSGDVNTGLGNCLLACTITKFLMEEIGVRSRLVNNGDDCVLICESGDC
FT                   RAVEDSLTVGWRRFGFTCIAEKPVYELEKIEFCQMSPIQMSDSRVKLVRKPQKSISKDA
FT                   HSTTPLTTIQLAQEWTRAIGEGGLSLTSGIPVVQEFYQCLIRNGKKATKESKKMAFYGD
FT                   YYWKWVNQHNGKYEPVTEEARHSFHLAFGVSPDQQLALEAIYSRKSLLWESSPFTFEVG
FT                   AIEWIFNQKIPI"
FT   gene            7. .729
FT                   /gene="p27"
FT   CDS             7. .729
FT                   /codon_start=1
FT                   /gene="p27"
FT                   /product="p27"
FT                   /note="replicase"
FT                   /db_xref="UniProtKB/TrEMBL:C6F397"
FT                   /protein_id="ACJ24785.1"
FT                   /translation="MAHYFGEALQLGLFAAKASCWASKELALLGPNLAWIATRPLRNDA
FT                   NAILERIGVHGLAKIPCNFDSDELTIANDCIVKSDRNLEDESIVVEEIEEGEEKKKSKK
FT                   VTRRRVKTKPTFAAVLAADAKNYYGCLPSATRANELSVMKYLVSKCQEHKLTITQTREV
FT                   SAMAFALTFTPDENDKLIYKYLNSTEVFERRVDYAKARGVDKCWFELLKRPWHARAWRR
FT                   VVGRIFGMPEQQAFEFVK"
FT   gene            2274. .2611
FT                   /gene="p12"
FT   CDS             join(2274. .2463,2463. .2611)
FT                   /codon_start=1
FT                   /ribosomal_slippage
FT                   /gene="p12"
FT                   /product="p12"
FT                   /db_xref="GOA:C6F398"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:C6F398"
FT                   /protein_id="ACJ24789.1"
FT                   /translation="MDIQSKDTNLSVKEPGKSAKRGSTKNKLDIAHSGVSKGTSRDLVG
FT                   ANFVTVADKVEFVVHLHFLVAYHSHICCTPTYLSALCCASSFVQFLARDRVIVIVTFLP
FT                   APVINSSQ"
FT   gene            2274. .2465
FT                   /gene="p7"
FT   CDS             2274. .2465
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="p7"
FT                   /note="movement protein"
FT                   /db_xref="GOA:C6F399"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:C6F399"
FT                   /protein_id="ACJ24786.1"
FT                   /translation="MDIQSKDTNLSVKEPGKSAKRGSTKNKLDIAHSGVSKGTSRDLVG
FT                   ANFVTVADKVEFVVHLHF"
FT   gene            2371. .2637
FT                   /gene="p9"
FT   CDS             2371. .2637
FT                   /codon_start=1
FT                   /transl_except=(pos:2371. .2373,aa:Met)
FT                   /gene="p9"
FT                   /product="p9"
FT                   /note="movement protein; non-canonical start codon"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3A0"
FT                   /protein_id="ACJ24787.1"
FT                   /translation="MEYPRVHLAILSVLILSQLLIKWNLWSISISSCLPQPHLLHPNLL
FT                   VCIVLCIFFCSVLSQGQSYSYSYFSTSTSDKFISVAVGNGGQG"
FT   gene            2621. .3637
FT                   /gene="p37"
FT   CDS             2621. .3637
FT                   /codon_start=1
FT                   /gene="p37"
FT                   /product="p37"
FT                   /note="coat protein"
FT                   /db_xref="GOA:C6F3A1"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3A1"
FT                   /protein_id="ACJ24788.1"
FT                   /translation="MAAKDNPAVLAAVARREQWAIKLQSKGWGSLSKAQKATARSYGIG
FT                   NPPTVVVPRTTRLVAGNPMNARRARGEPGNAKMGTTITKQEYMGELHSSSKIETYLLDP
FT                   KNVRSFPQLSGLAIGYNKYKITDFKVRYSPKCSDSECGLTIAYSSDSSDPPPKNKFNLF
FT                   SMNNKYETAAHKPLLVTLPVSKETRILRDKCTDDSKLVDSGAVHVLVDGNHEGRLGELF
FT                   FELTIVFSEPTFCNHHSQVIKGLKESEGPEYVKLEPNKETVRLVFQAAGAYLISIVASK
FT                   LEQIGQLGASEGDKLVVESADKSACLCRIEAEQPGSAIVLVYASREAITLRAYINKL"
FT   3'UTR           3638. .3883
XX
SQ   Sequence 3883 BP; 1046 A; 900 C; 1055 G; 882 T; 0 other;

eu849616 Length: 3883  28-JAN-2011  Type: N  Check: 1818  ..

       1  aacaaaatgg cacactattt tggggaggca ctgcaattgg gtttgttcgc
      51  tgctaaggcc agttgctggg ccagcaagga gttggcgctc cttggcccta
     101  acctcgcctg gatagcaacc agaccacttc gcaatgatgc taatgccatt
     151  ctagagagga ttggcgtcca cgggttggcc aaaatcccgt gcaacttcga
     201  ctccgatgag ttgacgatcg caaatgactg cattgtgaag tccgacagga
     251  acttggagga tgaatcgatt gtggtggagg agatcgaaga gggggaggag
     301  aaaaagaaga gcaagaaggt gacaaggaga agggtgaaga ccaagcctac
     351  cttcgcggcc gtcttggcgg ccgatgcgaa gaattattac ggttgcctcc
     401  caagtgccac cagggcaaac gagctcagcg tcatgaagta cttagtctcg
     451  aagtgtcaag agcataaact aaccataact cagacacgtg aggtaagtgc
     501  catggctttt gcgttgacct tcacgccaga tgaaaacgac aaactcatct
     551  acaaatacct caattcaacc gaggtgtttg aacgacgagt ggattatgct
     601  aaggcgcgag gggttgacaa gtgctggttc gaactgctca agaggccttg
     651  gcacgctcga gcatggagga gggtggtagg gcggattttc gggatgcctg
     701  agcagcaggc tttcgagttc gtcaaatagg gatgcctcat ggacacttgt
     751  ggtgtggaca cgaaagtgta ccgcggggaa caccactggg ttaaggagtt
     801  ccgtggggcg gcaaacccca agccgcgtag gttgtataag attagtggcg
     851  tatcccctga agttagatgg ggggtgcaca acaatagttt tgtcaacctc
     901  agaagagggt taatggaaag ggttttctac gtcgaaagat gcgggaagct
     951  cctaccgtgt ccgtctccgg aggcaggttt gttcaaacgg ttgttcaaca
    1001  aggttggacg gcgggtgatt aggttttgcg gccatcattc cccgatcccc
    1051  agggcttcat accctgggat gtttcagggc aggaagcgca cgatttatga
    1101  gaacgcagtc cggtcccttg ttgaccgacc atataatatt agagatagct
    1151  atttaaagac ttttgttaag tttgaaaagt tagactttag caagaaacct
    1201  gatcccgcgc ctagggtcat ccaacccagg catccgaggt acaacgtaga
    1251  actcggaaga tatttgaagc cttttgagca cttttgctac aaggcactag
    1301  acaagttgtg gggagggccc accgttatga aaggatacac agttgaggaa
    1351  atgggaggga ttatcaagga ctgttggctt caattccaga aaccagtggc
    1401  tattgggttc gacatgagtc gattcgatca acatgtttct gtggatgccc
    1451  tgaagtttga gcacagcatt tacaaggcct gcttctcgaa agatggaaat
    1501  ctggcaactt tgcttggtca ccagatatct aatagaggct cagcctatgc
    1551  caatgatggc tacttgagat acagagtgga agggaaaagg atgagcgggg
    1601  acgtgaacac aggactgggc aattgcttgt tggcgtgcac catcaccaaa
    1651  tttttgatgg aagaaattgg cgtgaggtct agactggtaa acaacgggga
    1701  cgactgcgtg cttatatgtg agtctggaga ttgccgcgct gtcgaggata
    1751  gcttgacagt ggggtggcga cgatttggct tcacctgcat tgcggaaaaa
    1801  cccgtctacg agctggaaaa gatcgagttt tgtcaaatga gccctataca
    1851  gatgagtgat tctcgcgtca aactagtgag gaaaccccag aaaagcatat
    1901  ccaaagatgc acattccacc accccactca ccaccataca gctagctcaa
    1951  gaatggaccc gcgccattgg agaaggcggg ttatctctga ccagcggcat
    2001  cccagtagtc caggaattct accaatgcct catccgtaac ggaaagaaag
    2051  cgaccaagga atcaaagaaa atggccttct acggggacta ctattggaag
    2101  tgggtcaacc agcataacgg caagtatgaa ccggtgactg aggaagctcg
    2151  gcactcattc cacttggcgt ttggggttag ccctgaccaa cagttggcct
    2201  tggaggctat atactctcgc aagtcgctac tttgggagtc ctcccccttt
    2251  acatttgaag ttggcgctat cgaatggata ttcaatcaaa agataccaat
    2301  ctaagtgtaa aggagccagg gaaatcagca aagcgcggaa gcacaaagaa
    2351  caagctagac atagcgcaca gtggagtatc caagggtaca tctcgcgatc
    2401  ttgtcggtgc taattttgtc acagttgctg ataaagtgga atttgtggtc
    2451  catctccatt tctagttgct taccacagcc acatttgttg caccccaacc
    2501  tacttgtctg cattgtgttg tgcatcttct tttgttcagt tcttagccag
    2551  ggacagagtt atagttatag ttacttttct accagcacca gtgataaatt
    2601  catctcagta gctgtaggaa atggcggcca aggataatcc ggcagtcctc
    2651  gcagccgtgg cgaggcggga acaatgggca atcaagcttc aatccaaggg
    2701  ttggggctcc ctgtctaagg cccagaaagc cactgcacgc tcgtacggaa
    2751  tagggaatcc cccgacagtc gtggtgccac gcaccacccg gctggtggct
    2801  gggaacccca tgaacgcgcg gcgggcgcgg ggagagcctg gcaatgccaa
    2851  aatgggcacc accataacca agcaggaata catgggcgag cttcattctt
    2901  cttcaaagat tgaaacatac ttgctcgacc ccaaaaatgt gaggagcttc
    2951  cctcagttaa gcgggcttgc aatcggctac aacaagtaca agattactga
    3001  cttcaaggtg cggtacagtc ccaaatgtag cgacagtgag tgtgggttaa
    3051  ccatagctta ctccagcgac tcttcagacc caccgccgaa gaacaaattc
    3101  aacttgttta gcatgaacaa caagtacgaa acagccgcgc acaagccact
    3151  cctagtaaca cttcccgtgt ctaaagagac cagaatcttg cgggataagt
    3201  gtactgatga ttccaaactc gtagacagtg gggcggtgca tgtcctggta
    3251  gacgggaatc acgaaggcag gctcggagaa cttttcttcg agttaaccat
    3301  tgtgttctct gaaccaacct tttgcaatca ccactcccaa gtcatcaaag
    3351  gactcaaaga gagtgaagga cccgaatatg tcaaactcga gcctaacaag
    3401  gagaccgtga gactggtttt ccaggcagcg ggggcgtact taatctctat
    3451  agtggcctcc aaactagagc aaatcgggca gcttggtgct tctgaaggtg
    3501  acaagctggt agttgagagt gctgataaga gtgcctgcct ctgtagaata
    3551  gaggcggagc aacccggtag tgctatagta ttagtttatg ccagcaggga
    3601  ggctattacc ctgcgagctt acatcaacaa gctatgagga aagccactgc
    3651  ggtggggtca gtctcctggt gcgccaacac ccagaagggg agacaacttc
    3701  agtggttgat aacccgacgc ttagtgtaag ccttgaaaaa tccaaaaaca
    3751  gagtgctact gctttcagtg tgcgagcttt atttgctcac ttcctccgtc
    3801  gataaaatcc cgatttttcg ggtgggcttc ggcggacatc cttgatgaag
    3851  aacggggggg taacccaccc ccctgatctg ccc