Sequence of DPV Pelargonium line pattern virus

Pelargonium line pattern virus isolate SPA0 clone 1 putative movement protein (p7), putative movement protein (p9), and coat protein (CP) genes, complete cds.

ACC No: EU852912

Dated: 2011-01-28 | Length: 1817 | CRC: -2003796024

                
ID   EU852912; SV 1; linear; genomic RNA; STD; VRL; 1817 BP.
XX
AC   EU852912;
XX
DT   01-JUL-2009 (Rel. 101, Created)
DT   28-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Pelargonium line pattern virus isolate SPA0 clone 1 putative movement
DE   protein (p7), putative movement protein (p9), and coat protein (CP) genes,
DE   complete cds.
XX
KW   .
XX
OS   Pelargonium line pattern virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-1817
RX   PUBMED; 20979982.
RA   Castano A., Ruiz L., Elena S.F., Hernandez C.;
RT   "Population differentiation and selective constraints in Pelargonium line
RT   pattern virus";
RL   Virus Res. 155(1):274-282(2011).
XX
RN   [2]
RP   1-1817
RA   Castano A., Ruiz L., Hernandez C.;
RT   "Sequence variability of distinct isolates of Pelargonium line pattern
RT   virus";
RL   Unpublished.
XX
RN   [3]
RP   1-1817
RA   Castano A., Ruiz L., Hernandez C.;
RT   ;
RL   Submitted (26-JUN-2008) to the EMBL/GenBank/DDBJ databases.
RL   Instituto de Biologia Molecular y Celular de Plantas, Ingeniero Fausto Elio
RL   s/n, Valencia, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1817
FT                   /organism="Pelargonium line pattern virus"
FT                   /host="Pelargonium zonale"
FT                   /lab_host="Chenopodium quinoa"
FT                   /isolate="SPA0"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain"
FT                   /clone="1"
FT                   /db_xref="taxon:167019"
FT   gene            208. .399
FT                   /gene="p7"
FT   CDS             208. .399
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="putative movement protein"
FT                   /db_xref="GOA:C6F3J3"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3J3"
FT                   /protein_id="ACJ38436.1"
FT                   /translation="MDIQSKDTNLSVKEAGKSAKRGSTKNKLDIAHSGVSKGTSRDLVG
FT                   ANFVTVADKVEFVVHLNF"
FT   gene            305. .571
FT                   /gene="p9"
FT   CDS             305. .571
FT                   /codon_start=1
FT                   /transl_except=(pos:305. .307,aa:Met)
FT                   /gene="p9"
FT                   /product="putative movement protein"
FT                   /note="non-canonical start codon"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3J4"
FT                   /protein_id="ACJ38437.1"
FT                   /translation="MEYPRVHLAILSVLILSQLLIKWNLWSISISSCLPQPHLLHPNLL
FT                   VCIVLCIFFSSVLSQGQSYSYSYFSTSTSDKFISVAVGNGGQG"
FT   gene            555. .1571
FT                   /gene="CP"
FT   CDS             555. .1571
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:C6F3J5"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3J5"
FT                   /protein_id="ACJ38438.1"
FT                   /translation="MAAKDNPAVLAAVARREQWAIKLQSKGWGSLSKAQKATARSYGIG
FT                   NPPAVVVPRTTRLVAGNPMNVRRARGEPGNVKMGTTITKQEYMGELHSSSKIETYLLDP
FT                   KNVRSFPQLSGLAIGYNKYKITDFKVRYSPKCSDSECGLTIAYSSDSSDPPPKNKFNLF
FT                   SMNNKYETAAHKPLLVTLPVSKETRFLRDKCTDDSQLVDSGAVHVLVDGNHEGRLGEPF
FT                   FELTIVFSEPTFCNHHSQVIKGLKESEGPEYVKLEPDKETVKLVFQAAGAYLISIVASK
FT                   LERIGQLGASEGDKLVVESTDKSACLCRIEAEQPGSAVVLVYASREAITLRAYINKL"
FT   3'UTR           1572. .1817
XX
SQ   Sequence 1817 BP; 482 A; 440 C; 471 G; 424 T; 0 other;

eu852912 Length: 1817  28-JAN-2011  Type: N  Check: 2273  ..

       1  gaaaatggcc ttctacgggg actactattg gaagtgggtc aaccagcata
      51  acggcaagta tgaaccggtg actgaggaag ctcggcactc gttccacttg
     101  gcgtttgggg tcagccctga ccaacagttg gccttggagg ctatatactc
     151  ccgcaagtcg ctactttggg agtcctcccc ctttacattt gaagttggcg
     201  ctatcgaatg gatattcaat caaaagatac caatctaagt gtaaaggagg
     251  cagggaaatc agcaaagcgc ggaagtacaa agaacaagct agacatagct
     301  cacagtggag tatccaaggg tacatctcgc gatcttgtcg gtgctaattt
     351  tgtcacagtt gctgataaag tggaatttgt ggtccatctc aatttctagt
     401  tgcttaccac agccacattt gttgcaccct aatctacttg tctgcatcgt
     451  gttgtgcatc ttctttagtt cagttcttag ccagggacag agttatagtt
     501  atagttactt ttcaactagc accagtgata aattcatctc agtagctgta
     551  ggaaatggcg gccaaggata atccggcggt cctcgcagct gtggcaaggc
     601  gggagcaatg ggcgatcaag ctccaatcca agggttgggg ctctctgtcc
     651  aaggcccaaa aagccactgc acgctcgtac ggaataggga accctccggc
     701  agtcgtggtg cctcgcacta ctcggctggt ggctggaaac cccatgaacg
     751  tgcggcgggc gcggggagag cctggcaatg tcaaaatggg caccaccatt
     801  accaagcaag aatacatggg cgagcttcat tcttcttcaa agattgaaac
     851  ttacttgctc gaccccaaga atgtgaggag cttccctcag ttaagcgggc
     901  ttgcaatcgg ctataacaag tacaagatca ctgacttcaa ggtgcggtac
     951  agtcccaaat gtagcgacag tgagtgtggg ttaaccatag cttactccag
    1001  cgactcttca gacccaccgc cgaagaacaa attcaacttg tttagcatga
    1051  acaacaagta cgaaacagcc gcgcacaagc cactcctagt aacacttccc
    1101  gtgtctaaag agaccagatt cttgcgggat aagtgtactg atgattccca
    1151  gctcgtagat agtggggcgg tgcatgtctt ggtggacggg aatcacgaag
    1201  gcaggctagg agaacccttc ttcgagttaa ccatcgtgtt ttccgaacca
    1251  accttttgca accaccactc ccaagtcatc aaaggactca aagagagtga
    1301  agggcccgaa tatgttaaac ttgagcctga caaggagacc gtgaaactgg
    1351  ttttccaggc agcgggggcg tacttaattt ctatagtggc ctccaagcta
    1401  gagcgaatcg ggcagcttgg tgcttctgaa ggtgacaagc tggtagttga
    1451  aagtactgat aagagtgcct gcctctgtag aatagaggcg gagcaacccg
    1501  gtagtgctgt agtattagtt tatgccagca gggaggctat taccctgcga
    1551  gcttacatca ataagctatg aggaaagcca ctgcggtggg gtcagtctcc
    1601  tggtgcgcca acacccagaa ggggagacaa cttcagtggt tgataacccg
    1651  acgcttagtg taagcctaga aaaaaccaaa aacagagtgc tactactttc
    1701  agtgtgcgag ctttaatcgc tcacttcctc cgtcgataaa atcccgattt
    1751  ttcgggtggg cttcggcgga catccttaat gaagaacggg ggggtaaccc
    1801  acccccctga tctgccc