Sequence of DPV Pelargonium line pattern virus

Pelargonium line pattern virus isolate SPA3 clone 2 putative movement protein (p7), putative movement protein (p9), and coat protein (CP) genes, complete cds.

ACC No: EU852917

Dated: 2011-01-28 | Length: 1817 | CRC: -740699565

                
ID   EU852917; SV 1; linear; genomic RNA; STD; VRL; 1817 BP.
XX
AC   EU852917;
XX
DT   01-JUL-2009 (Rel. 101, Created)
DT   28-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Pelargonium line pattern virus isolate SPA3 clone 2 putative movement
DE   protein (p7), putative movement protein (p9), and coat protein (CP) genes,
DE   complete cds.
XX
KW   .
XX
OS   Pelargonium line pattern virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-1817
RX   PUBMED; 20979982.
RA   Castano A., Ruiz L., Elena S.F., Hernandez C.;
RT   "Population differentiation and selective constraints in Pelargonium line
RT   pattern virus";
RL   Virus Res. 155(1):274-282(2011).
XX
RN   [2]
RP   1-1817
RA   Castano A., Ruiz L., Hernandez C.;
RT   "Sequence variability of distinct isolates of Pelargonium line pattern
RT   virus";
RL   Unpublished.
XX
RN   [3]
RP   1-1817
RA   Castano A., Ruiz L., Hernandez C.;
RT   ;
RL   Submitted (26-JUN-2008) to the EMBL/GenBank/DDBJ databases.
RL   Instituto de Biologia Molecular y Celular de Plantas, Ingeniero Fausto Elio
RL   s/n, Valencia, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1817
FT                   /organism="Pelargonium line pattern virus"
FT                   /host="Pelargonium zonale"
FT                   /lab_host="Chenopodium quinoa"
FT                   /isolate="SPA3"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain"
FT                   /clone="2"
FT                   /db_xref="taxon:167019"
FT   gene            208. .399
FT                   /gene="p7"
FT   CDS             208. .399
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="putative movement protein"
FT                   /db_xref="GOA:C6F3K5"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3K5"
FT                   /protein_id="ACJ38451.1"
FT                   /translation="MDIQPKDTNLSVKEIGKSAKRGSTKNKLDIAHSGVSKGTSRDLVG
FT                   ANFVTVADKVEFVVHLNF"
FT   gene            305. .571
FT                   /gene="p9"
FT   CDS             305. .571
FT                   /codon_start=1
FT                   /transl_except=(pos:305. .307,aa:Met)
FT                   /gene="p9"
FT                   /product="putative movement protein"
FT                   /note="non-canonical start codon"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3K6"
FT                   /protein_id="ACJ38452.1"
FT                   /translation="MEYPRVHLVILSVLILSQLLIKWNLWSISISSYLPQPHLLHPNLL
FT                   VCVVLCIFFSSVLSQGQSYSYSYFSTSTSDKFISVAVGNGGQG"
FT   gene            555. .1571
FT                   /gene="CP"
FT   CDS             555. .1571
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:C6F3L0"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3L0"
FT                   /protein_id="ACJ38453.1"
FT                   /translation="MAAKDNPAVLAAVARREQWAIKLQSKGWGSLSKAQKATARSYGIG
FT                   NPPTVVVPRTTRLVAGNPMNARRARGEPGNAKMGTTITKQEYMGELHSSSKIKTYLLDP
FT                   KNVRSFPQLSGLAIGYNKYKITDFKVRYSPKCSDSECGLTIAYSSDSSDPPPKNKFNLF
FT                   SMNHKYETAAHKPLVVTLPVSKETRFLREKCTDDSKLVDSGAVHVMVDGNHEGRLGELF
FT                   FELTIVLSEPTFCNHHSQVIKGLKESEGPEYVKVEPDKETVKLVFQAAGAYLVSIVASK
FT                   LERIGQLGASEGDKLVVDGADKSACLCRIEAEQPGSAVVLVYASREAITLRAHINKL"
XX
SQ   Sequence 1817 BP; 482 A; 446 C; 473 G; 416 T; 0 other;

eu852917 Length: 1817  28-JAN-2011  Type: N  Check: 6067  ..

       1  gaaaatggcc ttctacgggg actactattg gaagtgggtg aaccagcata
      51  acggcaagta tgaaccggtg actgaggaag ctcggcactc attccacttg
     101  gcgtttgggg tcagccctga ccaacagttg gccctagagg ccatatactc
     151  tcgcaagtcg ctactttggg agtcctcccc ctttacattt gaagttggcg
     201  ctatcgaatg gatattcaac caaaagatac caatctaagt gtaaaggaga
     251  tagggaaatc agcaaagcgc ggaagcacaa agaacaagct agatatagct
     301  cacagtggag tatccaaggg tacatctcgt gatcttgtcg gtgctaattt
     351  tgtcacagtt gctgataaag tggaatttgt ggtccatctc aatttctagt
     401  tacttgccac agccacactt gttgcacccg aacctacttg tctgcgtcgt
     451  gttgtgcatt ttcttcagtt cagttcttag ccagggacag agttatagtt
     501  atagttactt ttcaaccagc actagtgata aattcatctc agtagctgta
     551  ggtaatggcg gccaaggata atccggcagt tctcgcagcc gtggcgcggc
     601  gggaacaatg ggcaatcaag ctccaatcca agggttgggg ctccctgtcc
     651  aaggcccaga aagccactgc acgctcgtac ggaataggga accctccaac
     701  agtcgtggtg ccacgcacta cccggctggt ggcagggaac cccatgaacg
     751  cgcggcgggc gcggggagag cccggcaatg ccaagatggg caccaccata
     801  accaagcaag aatacatggg cgagcttcat tcttcttcaa agattaaaac
     851  ttacttgctc gaccccaaga atgtaaggag cttccctcag ttaagcgggc
     901  ttgcaatcgg ctataacaag tacaagatca ctgacttcaa ggtgcggtac
     951  agtcccaaat gcagcgacag tgagtgtggg ttaaccatag cttactccag
    1001  cgactcttca gacccacctc cgaagaacaa attcaacttg tttagcatga
    1051  accacaagta cgaaacggcc gcgcacaagc cactcgtagt aacacttccc
    1101  gtgtctaaag agaccagatt cttgcgggaa aagtgtactg atgattccaa
    1151  actcgtagac agtggggcgg tgcacgtaat ggtagacggg aatcacgaag
    1201  gtcggcttgg agaacttttc ttcgagttaa ccatcgtgct ttctgaacct
    1251  accttttgca atcaccactc ccaagtcatt aaaggactca aggagagtga
    1301  agggcccgaa tatgtcaaag ttgagcctga caaggagacc gtgaaacttg
    1351  ttttccaggc agcgggggcg tacttagttt ctatagtggc ctccaaacta
    1401  gagcgaatcg ggcagcttgg tgcttctgaa ggtgacaagc tggtagtgga
    1451  tggtgctgat aagagcgcct gcctctgtag aatagaggcg gagcaacctg
    1501  gtagtgctgt agtattagtg tatgccagca gggaggccat taccctgcga
    1551  gctcatatca acaagctatg aggaaagcca ctgcggtggg gtcagtctcc
    1601  tggtgcgcca acacccagaa ggggagacaa cttcagtggt tgataacccg
    1651  atgcttagta tgagcctaga aaaacctaaa aacagagtgc tactgctttc
    1701  agcgtgcgag ctttatttgc tcacttcctc cgtcgataaa atcccgattt
    1751  ctcgggtggg cttcggcgga catccttaat gaagaacggg ggggtaaccc
    1801  acccccctga tctgccc