Sequence of DPV Pelargonium line pattern virus

Pelargonium line pattern virus isolate SPA4 clone 2 putative movement protein (p7), putative movement protein (p9), and coat protein (CP) genes, complete cds.

ACC No: EU852918

Dated: 2011-01-28 | Length: 1817 | CRC: -1875324423

                
ID   EU852918; SV 1; linear; genomic RNA; STD; VRL; 1817 BP.
XX
AC   EU852918;
XX
DT   01-JUL-2009 (Rel. 101, Created)
DT   28-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Pelargonium line pattern virus isolate SPA4 clone 2 putative movement
DE   protein (p7), putative movement protein (p9), and coat protein (CP) genes,
DE   complete cds.
XX
KW   .
XX
OS   Pelargonium line pattern virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-1817
RX   PUBMED; 20979982.
RA   Castano A., Ruiz L., Elena S.F., Hernandez C.;
RT   "Population differentiation and selective constraints in Pelargonium line
RT   pattern virus";
RL   Virus Res. 155(1):274-282(2011).
XX
RN   [2]
RP   1-1817
RA   Castano A., Ruiz L., Hernandez C.;
RT   "Sequence variability of distinct isolates of Pelargonium line pattern
RT   virus";
RL   Unpublished.
XX
RN   [3]
RP   1-1817
RA   Castano A., Ruiz L., Hernandez C.;
RT   ;
RL   Submitted (26-JUN-2008) to the EMBL/GenBank/DDBJ databases.
RL   Instituto de Biologia Molecular y Celular de Plantas, Ingeniero Fausto Elio
RL   s/n, Valencia, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1817
FT                   /organism="Pelargonium line pattern virus"
FT                   /host="Pelargonium zonale"
FT                   /lab_host="Chenopodium quinoa"
FT                   /isolate="SPA4"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain"
FT                   /clone="2"
FT                   /db_xref="taxon:167019"
FT   gene            208. .399
FT                   /gene="p7"
FT   CDS             208. .399
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="putative movement protein"
FT                   /db_xref="GOA:C6F399"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:C6F399"
FT                   /protein_id="ACJ38454.1"
FT                   /translation="MDIQSKDTNLSVKEPGKSAKRGSTKNKLDIAHSGVSKGTSRDLVG
FT                   ANFVTVADKVEFVVHLHF"
FT   gene            305. .571
FT                   /gene="p9"
FT   CDS             305. .571
FT                   /codon_start=1
FT                   /transl_except=(pos:305. .307,aa:Met)
FT                   /gene="p9"
FT                   /product="putative movement protein"
FT                   /note="non-canonical start codon"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3L2"
FT                   /protein_id="ACJ38455.1"
FT                   /translation="MEYPRVHLAILSVLILSQLLIKWNLWSISISSCLPQPHLLHPNLL
FT                   VCIVLCIFFCSVLSQGQSYSYSYFSTSTNDKFISVAVGNGGQG"
FT   gene            555. .1571
FT                   /gene="CP"
FT   CDS             555. .1571
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:C6F3L3"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3L3"
FT                   /protein_id="ACJ38456.1"
FT                   /translation="MAAKDNPAVLAAVARREQWAIKLQSKGWGSLSKAQKATARSYGIG
FT                   NPPTVVVPRTTRLVAGNPMNARRARGEPGNAKMGTTITKQEYMGELHSSSKIETYLLDP
FT                   KNVRSFPQLSGLAIGYNKYKITDFKVRYSPKCSDSECGLTIAYSGDSSDPPPKNKFNLF
FT                   SMNNKYETAAHKPLLVTLPVSKETRILRDKCTDDSKLVDSGAVHVLVDGNHEGRLGELF
FT                   FELTIVFSEPTFCNHHSQVIKGLKESEGPEYVKLEPNKETVKLVFQAAGAYLISIVASK
FT                   LERIGQLGASEGDKLVVESADKSACLCRIEAEQPGSAIVLVYASREAITLRAYINKL"
XX
SQ   Sequence 1817 BP; 484 A; 451 C; 467 G; 415 T; 0 other;

eu852918 Length: 1817  28-JAN-2011  Type: N  Check: 7556  ..

       1  gaaaatggcc ttctacgggg actactattg gaagtgggtc aaccagcata
      51  acggcaagta tgaaccggtg actgaggaag ctcggcactc attccacttg
     101  gcgtttgggg ttagccctga ccaacagttg gccttggagg ctatatactc
     151  tcgcaagtcg ctactttggg agtcctcccc ctttacattt gaagttggcg
     201  ctatcgaatg gatattcaat caaaagatac caatctaagt gtaaaggagc
     251  cggggaaatc agcaaagcgc ggaagcacaa agaacaagct agacatagcg
     301  cacagtggag tatccaaggg tacatctcgc gatcttgtcg gtgctaattt
     351  tgtcacagtt gctgataaag tggaatttgt ggtccatctc catttctagt
     401  tgcttaccac agccacattt gttgcacccc aacctacttg tctgcattgt
     451  gttgtgcatc ttcttttgtt cagttcttag ccagggacag agttatagtt
     501  atagttactt ttctaccagc accaatgata aattcatctc agtagctgta
     551  ggaaatggcg gccaaggata atccggcagt cctcgcagcc gtggcgaggc
     601  gggaacaatg ggcaatcaag cttcaatcca agggttgggg ctccctgtct
     651  aaggcccaga aagccactgc acgctcgtac ggaataggga accccccgac
     701  agtcgtggtg ccacgcacca cccggctggt ggctgggaac cccatgaacg
     751  cgcggcgggc gcggggagag cctggcaatg ccaaaatggg caccaccata
     801  accaagcagg aatacatggg cgagcttcat tcttcatcaa agattgaaac
     851  atacttgctc gaccccaaaa atgtgaggag cttccctcag ttaagcgggc
     901  ttgcaatcgg ctacaacaag tacaagatta ctgacttcaa ggtgcggtac
     951  agtcccaaat gtagcgacag tgagtgtggg ttaaccatag cttactccgg
    1001  cgactcttca gacccaccgc cgaagaacaa attcaacttg tttagcatga
    1051  acaacaagta cgaaacagcc gcgcacaagc cactcctagt aacacttccc
    1101  gtgtctaaag agaccagaat cttgcgggat aagtgtactg atgattccaa
    1151  actcgtagac agtggggcgg tgcatgtcct ggtagacggg aatcacgaag
    1201  gcaggctcgg agaacttttc ttcgagttaa ccattgtgtt ctctgaacca
    1251  accttttgca atcaccactc ccaagtcatc aaaggactca aagagagtga
    1301  aggacccgaa tatgtcaaac tcgagcctaa caaggagacc gtaaaactgg
    1351  ttttccaggc agcgggggcg tacttaatct ctatagtggc ctccaaacta
    1401  gagcgaatcg ggcagcttgg tgcttctgaa ggtgacaagc tggtagttga
    1451  gagtgctgat aagagtgcct gcctctgtag aatagaggcg gagcaacccg
    1501  gtagtgctat agtattagtt tatgccagca gggaggctat taccctgcga
    1551  gcttacatca acaagctatg aggaaagcca ctgcggtggg gtcagtctcc
    1601  tggtgcgcca acacccagaa ggggagacaa cttcagtggt tgacaacccg
    1651  acgcttagtg taagccttga agaatccaaa aacagagtgc tactgctttc
    1701  agtgtgcgag ctttatttgc tcacttcctc cgtcgataaa atcccgattt
    1751  ttccggtggg cttcggcgga catccttgat gaagaacggg ggggtaaccc
    1801  acccccctga tctgccc