Sequence of DPV Pelargonium line pattern virus

Pelargonium line pattern virus isolate SPA7 clone 2 putative movement protein (p7), putative movement protein (p9), and coat protein (CP) genes, complete cds.

ACC No: EU852920

Dated: 2011-01-28 | Length: 1817 | CRC: -581863851

                
ID   EU852920; SV 1; linear; genomic RNA; STD; VRL; 1817 BP.
XX
AC   EU852920;
XX
DT   01-JUL-2009 (Rel. 101, Created)
DT   28-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Pelargonium line pattern virus isolate SPA7 clone 2 putative movement
DE   protein (p7), putative movement protein (p9), and coat protein (CP) genes,
DE   complete cds.
XX
KW   .
XX
OS   Pelargonium line pattern virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-1817
RX   PUBMED; 20979982.
RA   Castano A., Ruiz L., Elena S.F., Hernandez C.;
RT   "Population differentiation and selective constraints in Pelargonium line
RT   pattern virus";
RL   Virus Res. 155(1):274-282(2011).
XX
RN   [2]
RP   1-1817
RA   Castano A., Ruiz L., Hernandez C.;
RT   "Sequence variability of distinct isolates of Pelargonium line pattern
RT   virus";
RL   Unpublished.
XX
RN   [3]
RP   1-1817
RA   Castano A., Ruiz L., Hernandez C.;
RT   ;
RL   Submitted (26-JUN-2008) to the EMBL/GenBank/DDBJ databases.
RL   Instituto de Biologia Molecular y Celular de Plantas, Ingeniero Fausto Elio
RL   s/n, Valencia, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1817
FT                   /organism="Pelargonium line pattern virus"
FT                   /host="Pelargonium zonale"
FT                   /lab_host="Chenopodium quinoa"
FT                   /isolate="SPA7"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain"
FT                   /clone="2"
FT                   /db_xref="taxon:167019"
FT   gene            208. .399
FT                   /gene="p7"
FT   CDS             208. .399
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="putative movement protein"
FT                   /db_xref="GOA:C6F3J9"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3J9"
FT                   /protein_id="ACJ38460.1"
FT                   /translation="MDIQPKDTNLSVKEAGKSAKRGSTKNKLDIAHSGVSKGTSRDLVG
FT                   ANFVTVADKVEFVVHLHF"
FT   gene            305. .571
FT                   /gene="p9"
FT   CDS             305. .571
FT                   /codon_start=1
FT                   /transl_except=(pos:305. .307,aa:Met)
FT                   /gene="p9"
FT                   /product="putative movement protein"
FT                   /note="non-canonical start codon"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3L5"
FT                   /protein_id="ACJ38461.1"
FT                   /translation="MEYPRVHLAILSVLILSQLLIKWNLWSISIFSCLPQPHLLHPNLL
FT                   VCIVLCIFFSSVLSQGQSYSYSYFSTSTSDKFISVAVGNGGQG"
FT   gene            555. .1571
FT                   /gene="CP"
FT   CDS             555. .1571
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:C6F3L9"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3L9"
FT                   /protein_id="ACJ38462.1"
FT                   /translation="MAAKDNPAVLAAVARREQWAIKLQSKGWGSLSKAQKATARSYGIG
FT                   NPPTVVVPRTTRLVAGNPMNARRARGEPGNAKMGTTITKQEYMGELHSSSKIETYLLDP
FT                   KNVRSFPQLSGLAIGYNKYKITDFKVRYSPKCSDSECGLTIAYSSDSSDPPPKNKFNLF
FT                   SMNNKYETAAHKPLLVTLPVSKETRFLRDKCTDDSKLVDSGAVHVLVDGNHEGRLGELF
FT                   FELTIVFSEPTFCNHHSQVIKGLKESEGPEYVKIEPDKGTVKLVFQASGAYLISIVASK
FT                   LERIGQFGASEGDKLVVESADKSACLCRIEAEQPGSAIVLVYASREAITLRAYINKL"
XX
SQ   Sequence 1817 BP; 482 A; 447 C; 469 G; 419 T; 0 other;

eu852920 Length: 1817  28-JAN-2011  Type: N  Check: 1652  ..

       1  gaaaatggcc ttctacgggg actactattg gaagtgggtc aaccagcata
      51  acggcaagta tgaaccggtg actgaggaag ctcggcactc attccacttg
     101  gcgtttgggg tcagccctga ccaacagttg gccttagagg ctatatactc
     151  tcgcaagtcg ctactttggg agtcctcccc ctttacattt gaagttggcg
     201  ctatcgaatg gatattcaac caaaagatac caatctaagt gtaaaggagg
     251  cagggaaatc agcaaagcgc ggaagcacaa agaacaagct agacatagct
     301  cacagtggag tatccaaggg tacatctcgc gatcttgtcg gtgctaattt
     351  tgtcacagtt gctgataaag tggaatttgt ggtccatctc catttttagt
     401  tgtttaccac agccacactt gttgcaccct aatctacttg tctgcatcgt
     451  gttgtgcatc ttctttagtt cagttcttag ccagggtcag agttatagtt
     501  atagttactt ttcaactagc accagtgata aattcatctc agtagctgta
     551  ggaaatggcg gccaaggata atccggctgt cctcgcagcc gtggcgaggc
     601  gggaacaatg ggcaatcaag cttcaatcca agggttgggg ctccctgtcc
     651  aaggcccaaa aagccaccgc acgctcgtac gggataggga accccccgac
     701  agtcgtggtg cctcgcacta ctcggctggt ggcggggaac cccatgaacg
     751  cgcggcgggc gcggggagag cctgggaatg ccaaaatggg caccaccata
     801  accaagcaag aatacatggg cgagctccat tcttcttcaa agattgaaac
     851  ttacttgctc gaccccaaga atgtgaggag cttccctcag ttaagcgggc
     901  ttgcaatcgg ctacaacaag tacaagatca ctgacttcaa agtgcggtac
     951  agtcccaagt gtagcgacag cgagtgtggg ttaaccatag cctactctag
    1001  cgactcttca gacccaccgc caaagaacaa atttaacttg tttagcatga
    1051  acaacaagta cgaaacagcc gcgcacaagc cactcctagt aacacttccc
    1101  gtgtctaaag agaccagatt cttgcgggat aagtgtactg atgattccaa
    1151  gctcgtagac agtggggcgg tgcatgtcct ggtggacggg aatcacgaag
    1201  gcaggctcgg agaactcttc ttcgagttga ccatcgtgtt ttctgaacca
    1251  accttttgca atcaccactc ccaagtcatc aaaggactca aagagagtga
    1301  agggcccgaa tatgtcaaaa ttgagcctga caaggggacc gtgaaactgg
    1351  ttttccaggc atcgggggcg tacttaattt ctatagtggc ctccaaatta
    1401  gagcgaatcg ggcagtttgg tgcttctgaa ggtgacaagc tggtagttga
    1451  aagtgctgat aagagtgcct gcctctgtag aatagaggcg gagcaacccg
    1501  gtagtgctat agtattagtt tatgccagca gggaggccat taccctgcga
    1551  gcttacatca acaagctatg aggaaagcca ctgcggtggg gtcagtctcc
    1601  tggtgcgcca acacccagaa ggggagacaa cttcagtggt tcttaaccca
    1651  atgcttagag taagcctaga aaaacccaaa aacagagtgc tactgctttc
    1701  agtgtgcgag ctttatttgc tcacttcctc cgtcgataaa atcccgactt
    1751  gtcgggtggg cttcggcgga catccttaat gaagaacggg ggggtaaccc
    1801  acccccctga tctgccc