Sequence of DPV Pelargonium line pattern virus

Pelargonium line pattern virus isolate SPA8 clone 1 putative movement protein (p7), putative movement protein (p9), and coat protein (CP) genes, complete cds.

ACC No: EU852921

Dated: 2011-01-28 | Length: 1817 | CRC: -827502520

                
ID   EU852921; SV 1; linear; genomic RNA; STD; VRL; 1817 BP.
XX
AC   EU852921;
XX
DT   01-JUL-2009 (Rel. 101, Created)
DT   28-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Pelargonium line pattern virus isolate SPA8 clone 1 putative movement
DE   protein (p7), putative movement protein (p9), and coat protein (CP) genes,
DE   complete cds.
XX
KW   .
XX
OS   Pelargonium line pattern virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-1817
RX   PUBMED; 20979982.
RA   Castano A., Ruiz L., Elena S.F., Hernandez C.;
RT   "Population differentiation and selective constraints in Pelargonium line
RT   pattern virus";
RL   Virus Res. 155(1):274-282(2011).
XX
RN   [2]
RP   1-1817
RA   Castano A., Ruiz L., Hernandez C.;
RT   "Sequence variability of distinct isolates of Pelargonium line pattern
RT   virus";
RL   Unpublished.
XX
RN   [3]
RP   1-1817
RA   Castano A., Ruiz L., Hernandez C.;
RT   ;
RL   Submitted (26-JUN-2008) to the EMBL/GenBank/DDBJ databases.
RL   Instituto de Biologia Molecular y Celular de Plantas, Ingeniero Fausto Elio
RL   s/n, Valencia, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1817
FT                   /organism="Pelargonium line pattern virus"
FT                   /host="Pelargonium zonale"
FT                   /lab_host="Chenopodium quinoa"
FT                   /isolate="SPA8"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain"
FT                   /clone="1"
FT                   /db_xref="taxon:167019"
FT   gene            208. .399
FT                   /gene="p7"
FT   CDS             208. .399
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="putative movement protein"
FT                   /db_xref="GOA:C6F3J9"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3J9"
FT                   /protein_id="ACJ38463.1"
FT                   /translation="MDIQPKDTNLSVKEAGKSAKRGSTKNKLDIAHSGVSKGTSRDLVG
FT                   ANFVTVADKVEFVVHLHF"
FT   gene            305. .571
FT                   /gene="p9"
FT   CDS             305. .571
FT                   /codon_start=1
FT                   /transl_except=(pos:305. .307,aa:Met)
FT                   /gene="p9"
FT                   /product="putative movement protein"
FT                   /note="non-canonical start codon"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3K0"
FT                   /protein_id="ACJ38464.1"
FT                   /translation="MEYPRVHLAILSVLILSQLLIKWNLWYISISSFLPQPHLLHPNLL
FT                   VCIVLCIFFSSVLSQGQSYSYSYISTSTSDKFISVAVGNGGQG"
FT   gene            555. .1571
FT                   /gene="CP"
FT   CDS             555. .1571
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:C6F3M2"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3M2"
FT                   /protein_id="ACJ38465.1"
FT                   /translation="MAAKDNPAVLAAVARREQWAIKLQSKGWGSLSKAQKATARSYGIG
FT                   NPPTVVVPRTTRLVAGNPMNARRARGEPGNAKMGTTITKQEYMGELHSSSRIETYLLDP
FT                   KNVRSFPQLSGLAIGYNKYKITDFKVRYSPKCSDSECGLTIAYSSDSSDPPPKNKFNLF
FT                   SMNHKYETAAHKPLLVTLPVSKETRFLRDKCTDDSKLVDSGAVHVLVDGNHEGRLGELF
FT                   FELTIVFSEPTFCNHHSQVIKGLKESEGPEYVKLEPDKETVKLVFQAAGAYLISIVASK
FT                   LERIGQLGASEGDKLVVEGADKSACLCRIEAEQPGSAVVLVYASREAITLRAYINKL"
XX
SQ   Sequence 1817 BP; 477 A; 445 C; 476 G; 419 T; 0 other;

eu852921 Length: 1817  28-JAN-2011  Type: N  Check: 1629  ..

       1  gaaaatggcc ttctacgggg actactattg gaagtgggtc aaccagcata
      51  acggcaagta tgaaccggtg accgaggaag ctcgacactc attccacttg
     101  gcgtttggga ttagccctga ccaacagttg gccttagagg ctatatacgc
     151  tcgcaagtcg ctactttggg agtcctcccc ctttacattt gaagttggcg
     201  ctatcgaatg gatattcaac caaaagatac caatctgagt gtaaaggaag
     251  cagggaaatc agcaaagcgc ggaagtacaa agaacaagct agacatagcg
     301  cacagtggag tatccaaggg tacatctcgc gatcttgtcg gtgctaattt
     351  tgtcacagtt gctgataaag tggaatttgt ggtacatctc catttctagt
     401  ttcttaccac agccacactt gttgcaccct aatctgcttg tctgcattgt
     451  gttgtgcatc ttcttcagtt cagttcttag ccagggacag agttatagtt
     501  atagttacat ttcaactagc accagcgata aattcatctc agtagctgta
     551  ggaaatggcg gccaaggata atccggcagt cctcgcagcc gtggcgaggc
     601  gggaacaatg ggcgatcaag ctccaatcca agggttgggg ctctctgtca
     651  aaggcccaga aagccaccgc tcgctcgtac gggataggga atcctccgac
     701  agtcgtggtg cctcgcacta cccggctggt ggctggaaac cccatgaacg
     751  cgcggcgggc gcggggagag cctggtaatg ccaaaatggg caccaccata
     801  accaagcaag aatacatggg cgagcttcat tcttcttcaa ggattgaaac
     851  ttacttgctc gaccccaaga atgtgaggag cttccctcag ttaagcgggc
     901  ttgcaatcgg ctacaacaag tacaagatta ctgacttcaa ggtgcggtac
     951  agccctaaat gtagcgacag tgagtgtggg ttaaccatag cttactccag
    1001  cgactcttca gacccaccgc cgaagaacaa attcaacttg tttagcatga
    1051  accacaagta cgaaacagcc gcgcacaagc cactcctagt aacacttccc
    1101  gtgtccaaag agaccagatt cttgcgggat aagtgtactg atgattccaa
    1151  gctcgtagac agtggggcgg tgcatgtcct ggtggacggg aatcacgagg
    1201  gcaggctcgg agagcttttc ttcgagttga ccatcgtgtt ttctgagcca
    1251  accttttgca atcaccactc ccaagttatc aagggactca aagagagtga
    1301  aggacccgaa tatgtcaaac ttgagcctga caaggagacc gtgaaactgg
    1351  ttttccaggc agcgggggcg tacttaattt ctatagtagc ctccaagcta
    1401  gagcgaatcg ggcagcttgg tgcttctgaa ggtgacaagc tggtagttga
    1451  aggtgctgat aagagtgcct gcctctgtag aatagaggcg gagcaacccg
    1501  gtagtgctgt agtattagtt tatgccagca gggaggccat taccctgcga
    1551  gcttacatca acaagctatg aggaaagcca ctgcggtggg gtcagtctcc
    1601  tggtgcgcca acacccagaa ggggagacaa cttcagtggt tgataacccg
    1651  atgcttagtg taagcctaga aaaacccaaa aacagagtgt tactgctttc
    1701  agcgtgcgag ctttatttgc tcacttcctc cgtcgataaa atcccgattt
    1751  ttcgggtggg cttcggcgga catccttaat gaagaacggg ggggtaaccc
    1801  acccccctga tctgccc