Sequence of DPV Pelargonium line pattern virus

Pelargonium line pattern virus isolate USA1 clone 2 putative movement protein (p7), putative movement protein (p9), and coat protein (CP) genes, complete cds.

ACC No: EU852924

Dated: 2011-01-28 | Length: 1816 | CRC: 2065025598

                
ID   EU852924; SV 1; linear; genomic RNA; STD; VRL; 1816 BP.
XX
AC   EU852924;
XX
DT   01-JUL-2009 (Rel. 101, Created)
DT   28-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Pelargonium line pattern virus isolate USA1 clone 2 putative movement
DE   protein (p7), putative movement protein (p9), and coat protein (CP) genes,
DE   complete cds.
XX
KW   .
XX
OS   Pelargonium line pattern virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-1816
RX   PUBMED; 20979982.
RA   Castano A., Ruiz L., Elena S.F., Hernandez C.;
RT   "Population differentiation and selective constraints in Pelargonium line
RT   pattern virus";
RL   Virus Res. 155(1):274-282(2011).
XX
RN   [2]
RP   1-1816
RA   Castano A., Ruiz L., Hernandez C.;
RT   "Sequence variability of distinct isolates of Pelargonium line pattern
RT   virus";
RL   Unpublished.
XX
RN   [3]
RP   1-1816
RA   Castano A., Ruiz L., Hernandez C.;
RT   ;
RL   Submitted (26-JUN-2008) to the EMBL/GenBank/DDBJ databases.
RL   Instituto de Biologia Molecular y Celular de Plantas, Ingeniero Fausto Elio
RL   s/n, Valencia, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1816
FT                   /organism="Pelargonium line pattern virus"
FT                   /host="Pelargonium peltatum"
FT                   /lab_host="Chenopodium quinoa"
FT                   /isolate="USA1"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /clone="2"
FT                   /db_xref="taxon:167019"
FT   gene            208. .399
FT                   /gene="p7"
FT   CDS             208. .399
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="putative movement protein"
FT                   /db_xref="GOA:C6F3M9"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3M9"
FT                   /protein_id="ACJ38472.1"
FT                   /translation="MDIQPKVTNLSVKEAGKSAKRGSTKNKLDVAHSGVSKGTSRDLVG
FT                   ANFVTVADKVEFVVHLNF"
FT   gene            305. .571
FT                   /gene="p9"
FT   CDS             305. .571
FT                   /codon_start=1
FT                   /transl_except=(pos:305. .307,aa:Met)
FT                   /gene="p9"
FT                   /product="putative movement protein"
FT                   /note="non-canonical start codon"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3N0"
FT                   /protein_id="ACJ38473.1"
FT                   /translation="MECPRAHLAILSVLILSQLLIKWSLWSISISDFLPQPHLLHPNLL
FT                   VCIVLCIFFSSVLSQGQSYSYSYISTSTSDKFISVAVGNGGQG"
FT   gene            555. .1571
FT                   /gene="CP"
FT   CDS             555. .1571
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:C6F3N1"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3N1"
FT                   /protein_id="ACJ38474.1"
FT                   /translation="MAAKDNPAVIAAVARREQWAIKLQSKGWGSLSKAQKATARSYGIG
FT                   NLPTAVVPRTTRLVAGNPTNARRARGEPGNAKMGTTITKQEYMGELRSSSKIETYLLDP
FT                   KNVRSFPQLSGLAIGYNKYKITDFKVRYSPKCSDSGCGLTIAYSSDSSDPPPKNKFNLF
FT                   SMNHKYETAAHKPLLVTLPVSKETRFLRDKCSDDSKLVDSGAVHVLVDGNHEGRLGELF
FT                   FELTIVFSEPTFCNHHSQVIKGIKESEGPEYVKVEPDKETVKLVFQAAGAYLISIVASK
FT                   LERIGQLGASEGDKLVVESADKSACLCRMEAEQPGSAIVLVYASREAITLRAYINKL"
XX
SQ   Sequence 1816 BP; 477 A; 448 C; 474 G; 417 T; 0 other;

eu852924 Length: 1816  28-JAN-2011  Type: N  Check: 5218  ..

       1  gaaaatggcc ttctacgggg actactattg gaagtgggtt aaccagcaca
      51  gcggcaagta tgagccggtg accgaggcag ctcggcactc attccacttg
     101  gcgtttggag tcagccctga ccaacagttg gccctagagg ccatatactc
     151  tcgcaagtcg ctactttggg aggcctcccc ctttacattt gaagttggcg
     201  ctatcgaatg gatattcaac caaaagttac caatctgagt gtaaaggaag
     251  cagggaaatc agcaaagcgt ggaagtacga agaacaagct cgacgtagct
     301  catagtggag tgtccaaggg cacatctcgc gatcttgtcg gtgctaattt
     351  tgtcacagtt gctgataaag tggagtttgt ggtccatctc aatttctgat
     401  ttcttaccac agccacattt gttgcacccc aatttacttg tctgcatcgt
     451  gttgtgcatc ttcttcagtt cagttcttag ccagggacag agttatagtt
     501  atagttatat ttcaaccagc actagtgata aattcatctc agtagctgta
     551  ggaaatggcg gccaaggata atccggcagt catcgcagcc gtggcaagac
     601  gggagcagtg ggcaatcaag ctccaatcca aaggttgggg ctctttgtcc
     651  aaagcccaga aagccacggc acgctcgtac gggataggga accttccaac
     701  tgccgtagtg ccccgcacaa ctcggctggt ggctgggaac cccaccaatg
     751  cacggcgtgc gcggggagag cctggcaatg ccaaaatggg caccaccata
     801  accaagcagg aatacatggg cgagctacgt tcttcttcga agattgaaac
     851  ctatctgctc gaccccaaga atgtgaggag cttccctcag ttaagcgggc
     901  ttgcaatcgg ctataacaag tacaagatca ctgacttcaa ggtgcggtac
     951  agtcccaaat gtagcgacag tgggtgtggg ttgaccatag cttactccag
    1001  cgactcatct gatccaccgc cgaagaacaa attcaacttg tttagcatga
    1051  accacaagta tgaaacggcc gcgcacaagc cactcctagt aacacttccc
    1101  gtgtctaaag agaccagatt cttgcgggac aagtgttctg atgattccaa
    1151  gcttgtggac agtggagcgg tgcatgtcct ggtggacggg aatcacgaag
    1201  gcaggctcgg cgaacttttc ttcgagttaa ccatcgtgtt ttccgaacct
    1251  accttctgca atcaccactc ccaagtcatc aaaggaatca aggagagtga
    1301  agggcccgaa tacgtcaaag ttgagcctga taaggagacc gtaaaacttg
    1351  ttttccaggc agcgggggca tacttaattt ctatagtggc ctccaaacta
    1401  gagcgaatcg ggcagcttgg agcttctgaa ggtgacaagc tggtagttga
    1451  gagtgctgat aagagtgcct gcctctgtag aatggaggca gagcaaccag
    1501  gtagtgctat agtattagtt tatgccagca gggaggccat taccctgcga
    1551  gcttacatca acaagctatg aggaaagcca ctgcggtggg gtcagtctcc
    1601  tggtgcgcca acacccagaa ggggagacaa cttcagtggt tcaaaacccg
    1651  acgcttagtg taagtctaga aaaaccaaaa acagagtgct actgctttca
    1701  gtgtgcgagc tttatttgct cacttcctcc gtcgataaaa tcccgagttt
    1751  tcgggtgggc tccggcggac atccttaatg aagaacgggg gggtaaccca
    1801  cccccctgat ctgccc