Sequence of DPV Pelargonium line pattern virus

Pelargonium line pattern virus isolate ITA4 clone 2 putative movement protein (p7), putative movement protein (p9), and coat protein (CP) genes, complete cds.

ACC No: EU852928

Dated: 2011-01-28 | Length: 1817 | CRC: -995505728

                
ID   EU852928; SV 1; linear; genomic RNA; STD; VRL; 1817 BP.
XX
AC   EU852928;
XX
DT   01-JUL-2009 (Rel. 101, Created)
DT   28-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Pelargonium line pattern virus isolate ITA4 clone 2 putative movement
DE   protein (p7), putative movement protein (p9), and coat protein (CP) genes,
DE   complete cds.
XX
KW   .
XX
OS   Pelargonium line pattern virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-1817
RX   PUBMED; 20979982.
RA   Castano A., Ruiz L., Elena S.F., Hernandez C.;
RT   "Population differentiation and selective constraints in Pelargonium line
RT   pattern virus";
RL   Virus Res. 155(1):274-282(2011).
XX
RN   [2]
RP   1-1817
RA   Castano A., Ruiz L., Hernandez C.;
RT   "Sequence variability of distinct isolates of Pelargonium line pattern
RT   virus";
RL   Unpublished.
XX
RN   [3]
RP   1-1817
RA   Castano A., Ruiz L., Hernandez C.;
RT   ;
RL   Submitted (26-JUN-2008) to the EMBL/GenBank/DDBJ databases.
RL   Instituto de Biologia Molecular y Celular de Plantas, Ingeniero Fausto Elio
RL   s/n, Valencia, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1817
FT                   /organism="Pelargonium line pattern virus"
FT                   /host="Pelargonium zonale"
FT                   /lab_host="Chenopodium quinoa"
FT                   /isolate="ITA4"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /clone="2"
FT                   /db_xref="taxon:167019"
FT   gene            208. .399
FT                   /gene="p7"
FT   CDS             208. .399
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="putative movement protein"
FT                   /db_xref="GOA:C6F3N2"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3N2"
FT                   /protein_id="ACJ38484.1"
FT                   /translation="MDIQSKDSNLIVKEAGKSAKRGSTKNKLDVAHSGVSKGTSRDIVG
FT                   ANFVTVADKVEFVVHLNF"
FT   gene            305. .571
FT                   /gene="p9"
FT   CDS             305. .571
FT                   /codon_start=1
FT                   /transl_except=(pos:305. .307,aa:Met)
FT                   /gene="p9"
FT                   /product="putative movement protein"
FT                   /note="non-canonical start codon"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3N3"
FT                   /protein_id="ACJ38485.1"
FT                   /translation="MEYPRVHLVTLSVLILSQLLIKWSLWSISISDFLPQPHLLHPNLL
FT                   VCIVLCIFFSSVLSQGQSYSYSYFSTSTSDKFISVAVGNGGQR"
FT   gene            555. .1571
FT                   /gene="CP"
FT   CDS             555. .1571
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:C6F3P3"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:C6F3P3"
FT                   /protein_id="ACJ38486.1"
FT                   /translation="MAAKDNPAVIAAVARREQWAIKLQSKGWGSLSKAQKATARSYGIG
FT                   NPPTVVVPRTTRLVAGNPTNARRARGEPGNAKMGTTITKQEYMGELHSSSKIETYLLDP
FT                   KNVRSFPQLSGLAIGYNKYKITDFKVRYSPKCSDSECGLTIAYSSDSSDPPPKNKFNLF
FT                   SMNHKYETAAHKPLLVTLPVSKETRFLRDKCTDDSKLVDSGAVHVLVDGKHEGRIGELF
FT                   FELTIVFSEPTFCNHHSQVIKGLKESEGPEYVKVEPDKESVRLVFQAAGAYLISIVASK
FT                   LERIGQLGASEGDKLVVESTDKSACLCRIEAEQPGSAVVLVYASREAITLRAYINKL"
XX
SQ   Sequence 1817 BP; 485 A; 436 C; 465 G; 431 T; 0 other;

eu852928 Length: 1817  28-JAN-2011  Type: N  Check: 8535  ..

       1  gaaaatggcc ttctacgggg actattattg gaagggggtc aatcagcata
      51  acggcaagta tgaaccggtg accgaggaag ctaggcactc attccacttg
     101  gcgtttgggg ttagccctga ccaacagttg gctctggaag ctatatactc
     151  tcgcaagtcg ctactttggg agtcctcccc ctttacattt gaagttggcg
     201  ctatcgaatg gatattcagt caaaagattc caatctgatt gtaaaggaag
     251  cagggaaatc agcaaagcgc ggaagtacaa agaacaagct agacgtggct
     301  cacagtggag tatccaaggg tacatctcgt gacattgtcg gtgctaattt
     351  tgtcacagtt gctgataaag tggagtttgt ggtccatctc aatttctgat
     401  ttcctaccac agccacactt attgcaccct aatctacttg tctgcattgt
     451  gttgtgcatt ttctttagtt cagttcttag ccagggacag agttatagtt
     501  atagttactt ttcaactagc accagtgata aattcatctc agtagctgta
     551  ggaaatggcg gccaaagata atccagcagt catcgcagcc gtggctaggc
     601  gggagcagtg ggcaatcaag cttcaatcca agggttgggg ctccttgtct
     651  aaagcccaga aagccaccgc acgctcgtac gggataggaa accctccaac
     701  agtcgtggtg cctcgcacta cccggctggt ggctgggaat cccacgaacg
     751  cacggcgagc gcgaggagag cctggcaatg ccaaaatggg caccaccata
     801  accaagcagg aatacatggg cgagcttcat tcttcttcaa agattgaaac
     851  ttacttgctc gaccccaaga atgtaaggag ctttcctcag ttaagcgggc
     901  ttgctatcgg ctataacaag tacaagatca ctgacttcaa ggtgcggtac
     951  agtcccaaat gcagcgacag tgagtgtggg ttgaccattg cttactccag
    1001  cgactcttct gatccaccgc cgaagaacaa attcaacttg tttagcatga
    1051  accacaagta tgaaacagcc gcgcacaagc cactcctagt aacacttccc
    1101  gtgtctaaag agaccagatt cttgcgggat aagtgtactg atgactccaa
    1151  actcgtagac agtggagcgg tgcatgtcct ggtggacggg aaacacgaag
    1201  gcaggatcgg agaacttttc ttcgagttaa ccatcgtgtt ttctgaacct
    1251  accttctgca atcaccactc ccaagtcatc aaagggctca aggagagtga
    1301  aggacccgag tacgtcaagg ttgagcctga caaggaaagc gtgagacttg
    1351  ttttccaggc agcgggggca tacttaattt ctatagtggc ctccaaacta
    1401  gagcgaatcg ggcaactggg tgcttctgaa ggcgacaagc tggtagttga
    1451  gagtactgat aagagtgcct gcctctgtag aatagaggca gagcaaccag
    1501  gtagcgctgt ggtattagtt tatgccagca gggaggccat taccctgcga
    1551  gcttacatca acaagctatg aggacagcca ctgcggtggg gtcagtctcc
    1601  tggtgcgcca acacccagaa ggggagacaa cttcagtggt tctcaacccg
    1651  atgcttaatg taagtttaag aaaatccaaa aacagagtgt tactgctttc
    1701  agtgtgcgag ctttatttgc tcacttcctc cgtcgataaa atcccgaatt
    1751  ttcgggtggg cttcggcgga catccttaat gaagaacggg ggggtaaccc
    1801  acccccctga tctgccc