Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CTV-B1 coat protein gene, complete cds.

ACC No: EU869296

Dated: 2010-07-13 | Length: 672 | CRC: -556139673

                
ID   EU869296; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU869296;
XX
DT   13-JUL-2010 (Rel. 105, Created)
DT   13-JUL-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CTV-B1 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Biswas K.K., Kumari S., Tarafdar A.;
RT   "Molecular characterization of Citrus tristeza virus isolates from south
RT   India";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Kumari S., Tarafdar A., Biswas K.K.;
RT   ;
RL   Submitted (03-JUL-2008) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, IARI, New Delhi, Delhi, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus limettioides"
FT                   /isolate="CTV-B1"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Bangalore, GKVK farm of University of
FT                   Agricultural Science"
FT                   /collection_date="Aug-2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACJ72041.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 122 C; 171 G; 182 T; 0 other;

eu869296 Length: 672  13-JUL-2010  Type: N  Check: 3189  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcgtcgt tacaaagcga cgatgatacc
     301  acgggtatga cgtacactcg ggaaggtgtt gaagtggaac tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agatctaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgt tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg actggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga