Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CTV-B4 truncated coat protein gene, complete cds.

ACC No: EU869299

Dated: 2010-07-13 | Length: 672 | CRC: 1289205137

                
ID   EU869299; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU869299;
XX
DT   13-JUL-2010 (Rel. 105, Created)
DT   13-JUL-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CTV-B4 truncated coat protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Biswas K.K., Kumari S., Tarafdar A.;
RT   "Molecular characterization of Citrus tristeza virus isolates from south
RT   India";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Kumari S., Tarafdar A., Biswas K.K.;
RT   ;
RL   Submitted (04-JUL-2008) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, IARI, New Delhi, Delhi, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus limettioides"
FT                   /isolate="CTV-B4"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Bangalore, IIHR, Hessarghatta"
FT                   /collection_date="Aug-2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .561
FT                   /codon_start=1
FT                   /product="truncated coat protein"
FT                   /protein_id="ACJ72044.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVDVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGYSGRVSLPVCRFLDRSWLD"
XX
SQ   Sequence 672 BP; 198 A; 129 C; 165 G; 180 T; 0 other;

eu869299 Length: 672  13-JUL-2010  Type: N  Check: 466  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgccg ctgagtcttc tttcggttcc atgaacttac
     101  acatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaaa agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gacgtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggt aaccgcacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgt tagatgcagg
     501  gtattccggc cgggtatcat tacctgtgtg cagatttctt gaccggagct
     551  ggcttgactg atttagaatg tgctgtgtac atacaagcta aagaacaatt
     601  gttgaagaag cgaggagctg atgaagtcgt agttaccaat gtcaggcagc
     651  ttgggaaatt tacacacgtt ga