Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CTV-B5 coat protein gene, complete cds.

ACC No: EU869300

Dated: 2010-07-13 | Length: 672 | CRC: -250845421

                
ID   EU869300; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU869300;
XX
DT   13-JUL-2010 (Rel. 105, Created)
DT   13-JUL-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CTV-B5 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Biswas K.K., Kumari S., Tarafdar A.;
RT   "Molecular characterization of Citrus tristeza virus isolates from south
RT   India";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Kumari S., Tarafdar A., Biswas K.K.;
RT   ;
RL   Submitted (04-JUL-2008) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, IARI, New Delhi, Delhi, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus limettioides"
FT                   /isolate="CTV-B5"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Bangalore, IIHR"
FT                   /collection_date="Aug-2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACJ72045.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAEPSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGEFNT
FT                   R"
XX
SQ   Sequence 672 BP; 200 A; 125 C; 169 G; 178 T; 0 other;

eu869300 Length: 672  13-JUL-2010  Type: N  Check: 3007  ..

       1  atggacgacg aaacaaagaa actgaagaac aaaaacaagg aaacgaaaga
      51  aggtgacgat gttgttgcag ctgagccttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt ggcagttaag agttcgtcat tacaaagcga cgatgatacc
     301  acgggtatga cgtacactcg ggaaggtgtt gaagtggaac tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg acgcccttta tttagctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagttgta gttaccaatg tcaggcagct
     651  tggggaattt aacacacgtt ga