Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CA-P117 P25 protein (CP) gene, complete cds.

ACC No: EU878381

Dated: 2008-10-03 | Length: 672 | CRC: 1464404886

                
ID   EU878381; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU878381;
XX
DT   13-AUG-2008 (Rel. 96, Created)
DT   03-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate CA-P117 P25 protein (CP) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Yokomi R., Polek M., Saponari M.;
RT   "Genetic diversity of Citrus tristeza virus isolates spreading in Central
RT   California";
RL   Phytopathology 98:S178-S178(2008).
XX
RN   [2]
RP   1-672
RA   Yokomi R., Saponari M.;
RT   ;
RL   Submitted (10-JUL-2008) to the EMBL/GenBank/DDBJ databases.
RL   San Joaquin Valley Agricultural Sciences Center, ARS-USDA, S. Riverbend,
RL   Parlier, CA 93648, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus medica"
FT                   /isolate="CA-P117"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="P25 protein"
FT                   /note="coat protein 25kDa"
FT                   /protein_id="ACG61332.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSSQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 122 C; 170 G; 183 T; 0 other;

eu878381 Length: 672  03-OCT-2008  Type: N  Check: 3236  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat cgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta tttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga