Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CA-P119 P27 protein (P27) gene, partial cds; and P25 protein (CP) gene, complete cds.

ACC No: EU878383

Dated: 2008-10-03 | Length: 846 | CRC: 1299556549

                
ID   EU878383; SV 1; linear; genomic RNA; STD; VRL; 846 BP.
XX
AC   EU878383;
XX
DT   13-AUG-2008 (Rel. 96, Created)
DT   03-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate CA-P119 P27 protein (P27) gene, partial cds;
DE   and P25 protein (CP) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-846
RA   Yokomi R., Polek M., Saponari M.;
RT   "Genetic diversity of Citrus tristeza virus isolates spreading in Central
RT   California";
RL   Phytopathology 98:S178-S178(2008).
XX
RN   [2]
RP   1-846
RA   Yokomi R., Saponari M.;
RT   ;
RL   Submitted (10-JUL-2008) to the EMBL/GenBank/DDBJ databases.
RL   San Joaquin Valley Agricultural Sciences Center, ARS-USDA, S. Riverbend,
RL   Parlier, CA 93648, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .846
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus medica"
FT                   /isolate="CA-P119"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /db_xref="taxon:12162"
FT   gene            <1. .75
FT                   /gene="P27"
FT   CDS             <1. .75
FT                   /codon_start=1
FT                   /gene="P27"
FT                   /product="P27 protein"
FT                   /note="minor coat protein 27kDa"
FT                   /protein_id="ACG61335.1"
FT                   /translation="MLARRQGYEEATEPLNLRDLGKYL"
FT   gene            175. .846
FT                   /gene="CP"
FT   CDS             175. .846
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="P25 protein"
FT                   /note="coat protein 25kDa"
FT                   /protein_id="ACG61336.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGTGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 846 BP; 240 A; 152 C; 214 G; 240 T; 0 other;

eu878383 Length: 846  03-OCT-2008  Type: N  Check: 6589  ..

       1  atgttagcta gacgtcaagg ttacgaggag gcaaccgagc ctcttaacct
      51  acgtgatttg ggtaagtact tgtagttggt ttggggacgg taatattatt
     101  attataccat cccttgagcg ctgctttaag ggtcgttaat tgacgactct
     151  tgatatattt actaggtttg aattatggac gacgaaacaa agaaattgaa
     201  gaacaaaaac aaggaaacga aagaaggcga cgatgttgtt gctgcggagt
     251  cttctttcgg ttccgtaaac ttacacatcg atccgaccct gataacgatg
     301  aacgatgtgc gtcagttgag tactcaacag aatgctgctt tgaacaggga
     351  cttatttctt gctctgaaag ggaagtatcc taacttgcct gacaaagata
     401  aggactttca catagctatg atgttatacc gtttagcggt taagagttca
     451  tcattgcaaa gtgatgatga caccacgggc ataacgtaca ctcgggaggg
     501  tgttgaagta gatttgtctg acaaactttg gaccgacatc gtgtataatt
     551  ctaagggtac tggtaaccga actaacgccc ttcgagtctg gggtagaact
     601  aacgatgctc tttacttagc cttttgtaga cagaaccgca atttgagtta
     651  tggcggacgt ccgctagatg cagggattcc ggctgggtat cattatttgt
     701  gtgcagattt cttgaccgga gctggcttga ctgatttaga atgtgctgtg
     751  tacatacaag ctaaagaaca attgttgaaa aagcgagggg ctgatgaggt
     801  tgtagttact aatgtcaggc agcttgggaa attcaacaca cgttga