Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain VT, complete genome.

ACC No: EU937519

Dated: 2008-11-26 | Length: 19251 | CRC: -1796793803

                
ID   EU937519; SV 1; linear; genomic RNA; STD; VRL; 19251 BP.
XX
AC   EU937519;
XX
DT   10-SEP-2008 (Rel. 97, Created)
DT   26-NOV-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Citrus tristeza virus strain VT, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19251
RX   DOI; 10.1371/journal.pone.0000917.
RX   PUBMED; 17878952.
RA   Weng Z., Barthelson R., Gowda S., Hilf M.E., Dawson W.O., Galbraith D.W.,
RA   Xiong Z.;
RT   "Persistent infection and promiscuous recombination of multiple genotypes
RT   of an RNA virus within a single host generate extensive diversity";
RL   PLoS One 2(9):E917-E917(2007).
XX
RN   [2]
RP   1-19251
RA   Weng Z., Yu Y., Gowda S., Galbraith D.W., Wing R.A., Dawson W.O., Xiong Z.;
RT   "High-throughput sequencing of an RNA virus complex revealed genome-wide,
RT   large scale recombination in a population of viral genomes";
RL   Unpublished.
XX
RN   [3]
RP   1-19251
RA   Xiong Z., Weng Z., Barthelson R., Gowda S., Hilf M.E., Dawson W.O.,
RA   Galbraith D.W.;
RT   ;
RL   Submitted (31-JUL-2008) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Sciences and BIO5 Institute, University of Arizona,
RL   Forbes 303, Tucson, AZ 85721, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19251
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis cv Hamlin"
FT                   /strain="VT"
FT                   /isolate="FS2-2"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Florida"
FT                   /collection_date="2004"
FT                   /note="contains three different CTV strains"
FT                   /db_xref="taxon:12162"
FT   CDS             108. .9455
FT                   /codon_start=1
FT                   /product="p1a"
FT                   /note="replication protein containing two protease domains,
FT                   one methyltransferase domain, and one helicase domain"
FT                   /protein_id="ACH79940.1"
FT                   /translation="MSKLGARFKSLTFAVRSDYIISRIWRAFNTVGVLHFFGTETTTKV
FT                   VKEFSAPQPIVPLRKSCFPFSVRAAVRAIKAAGRPIDAPRSGCLCGLPVIDTSGVVRPR
FT                   SVAGIWRYSLCKPPLTAAAKKSIRKAKKDSAFFLSRASSLFSREVPCGTRHRLRRRVMK
FT                   RVDPTMHESPQDEIKLKGRRHGKNSDLPYMGEAALDDILRWIEGVNPPPSMVAIPVPIS
FT                   FGAVPTTAWCSPADAAVLRCRLDYHAAETSFRDERKHVRYVYNDVSSAANRPRTVSPRK
FT                   CGRVFPSGSALGVEVPSTRDRHTAFVRSTHASVFFSDAVRRVRMFRPGRNNFFTSVVSG
FT                   RRVSYFRPGPNGTVSVLMSDGVNTARLDVVAPAYYAYAKALGAKVRCLWESSDLDDAKI
FT                   RDGQCYVRHVYDVALYFGRRVDLSVRRTLGLFPTVGALKAYLVREYGRESLKVPMRGTY
FT                   TFGSVFHCLSTKSFVDLRSIPNHHLVGGASAHVFIGQIRVDVPGGVSKPSRAAVRRRNR
FT                   RLREDGFLGSTDSSSSGGSRYCSDCSTPRSPPSPSIVGPTLGRIPSINRKFRFPAGTQL
FT                   SVSIPKRNDDRVYVSVGQDFDELCHAVCTYVKRYNSRKAFYTRFENGDDFAVIRRASVG
FT                   GLHVFVKRGNFTARFPMSASRYEHHYDASMKGAGLSWVRKSRFPNVEVIRRRRSRTGGS
FT                   LASFPDANLRINSDQPSDSVQAVPVSGENSPSSRGASSPRRDPVEGSGWYKVGSPSHHS
FT                   SAARGQRSTERGKIGDFSFPSSTVYNAHVDEHAYKRVLKLRDTSASSFLRIVLARLSSY
FT                   RPLSDEFFNKCVTSRFVACIEAVESGLVTVHFRSDVFRASFPFGVYLYTRHAFDIYSGK
FT                   LLQLDSYGFSEDLKDGYCYIRHIAEVCLSMGKVFFRRDVNLGAFPYVFEVQHRLERLYG
FT                   KRAVEYGVRGYFSATRLYHCCFTDSPRPFKSLNKYHKMGGEEGALLITDTDRLRAVGSA
FT                   YEKVKGRLPDSLLVRSVEKDLIEFNQTLVDTQRARPGVAVPFQMSENQQVMLTRAYPEF
FT                   NINFTHSVHSDHPVAAGSRMLENHLVRKYAGSDYSDVGGCPLFHLRAGHTGVHVCRPVY
FT                   DIKDAHRRVVRHHQLSKVAFDHTDGSKQVGAVNTNTVCGNVLGECFHASDAIVMVQVYD
FT                   VPLRELCRAMVNKKASVCYMTVVTPGELLDARESFFIKELDCSVELDAVADRVIYCFNN
FT                   SAYTHTYSTICEYMRTPCVVVDGFLFTIEMVSLRCSVNYYCITKSRVCPRISEIKRLRY
FT                   RRCDSDLIRIKIPRYSNKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTW
FT                   NYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAESFSRRLAAFSGD
FT                   TSLFELVRFAISEKCRDLFVGVQEAVERYVKSYLRNSFNISFADLSDPLLTISEYSELD
FT                   VPIDLPGFGCITEGDEAKLIEDGVKSALLRKAVRDEAQLILERGGTSEIVPCGDDDGLG
FT                   SDGSDSLLGSGSDSSSKASSGGLRAGAAPSLFRSLLKKLGGGFCMAKRLLDLLCERLVG
FT                   SLSRLKFGTTHLTSFFSMLRAKLSRNFFDDSIFTAVWDVVMNLIRIVNGVTRTKLECFR
FT                   NVLRLIPTLCSGCKDFAKDFANMCRLVLLFSTEFFSKSYAKLCRFSLEVFDVGLIEISA
FT                   RNMGLETCVSMASAIFDVVLTYPLGNISFPVVCARVFGALAMEVGSNYCFKKTFGKPEI
FT                   LGEDAFRRTVSMVLSAKAFDKLSIDSKGLVRCSGVIPGVLRIVFSSLFSDADAWVGYSK
FT                   HEVSSLPIITYSAKKLSFALEQTKEACIAFIIDSSKRILASLTSEIHESFQNLELTNGA
FT                   KSLYGHVSSVLSASNSVVSKAGNAVAAVKAAGSGLSKRVRRIRPSFRLARCVNEQTSEY
FT                   YSASDESDLDESLLSDTPGLRGNGKCNDLFRVISGRVSVCCRRAVEALKRLVLHVGDCL
FT                   YSRIMDSFVRLFVETNVAVGKCESFVVDCTRKISDLVIGYITWRNLHSGAYSTTPGLSG
FT                   GSRSSLSRFLDGGLTCVIRSIVTAWLTVFDETFYLSLVHRMRTASINVLLEFLKNLPVC
FT                   LVSIYTFIECRSRIFPLKEFLWGFCVFVWNIVKELSICIYGSLPVCVTRLCNRAFRRGS
FT                   NEGDVRTLQVITEAENRIEFLREVLAEMARYRASLEIPVPGSPDSPLFPPTYGEIEELG
FT                   NDSSDSARLIGVDNGLDSVPTESEAELDSDGDSDDSIPLDRDFEQIGGLGGSGNVDVFR
FT                   LGLKFVWRMLRNLFNLRAVKFSYGLALQCIFNGGSMGQFTSRLLFSFGNCLPFELFRHV
FT                   CSVRWLSKSLAIRVRNASICDEETVERFFSFSRFLYDSRYLSDVFSVLERVDFYLSYLF
FT                   SLPKRCLTRNRSVRVCARAPVRVIRDMGLVEDGKKSLTEVLNSLDSLKVSDRKGKSALI
FT                   ESDGSDSESGHSFGSISFGSVNEEVLEAVNGGVVSEKAPLMKHADALSRLEPDLSGKKD
FT                   LPIVRRSFTRGESSGTKPAGSLCVYLTTLNSSFGSVPDLYPVARDITYKKMTNAMREFY
FT                   YSQKVTLYELHGKLSSYWDELKTVGFNRKLAKMDLDDDVDVVDFNLKVIVGRHGTRPFR
FT                   NTVNSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFLRAVDGKDLTFTNSEHSL
FT                   IVYEAPPGGGKTHSLVTYFADYCTKVSCLVVTANKNSQAEISQRISRELMDRKMLAKHV
FT                   VKTAGRVFTVDSYLMNHIRLKTDLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSRQI
FT                   HYIHRNDFGVSLLHDIDAFIEPQHRIYGEVSYRCPWDICEWLSKFYPRHVATANTGSIG
FT                   KSSVSIEIINGCDDVPYDSSAKYIVYTQAEKNELQKHLGRLTVGRTKAVPIVNTVHEVQ
FT                   GETYKKVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLTYSVLNSRRYDKTASSIDEARE
FT                   IFDKFRSTNHSHGSSTLEWYLEKYPTEYKGSKASSAPLSCINEFLNEVVVGSSVVQLGD
FT                   TSEELSSRPFESGCDNITVRDTAPPDSGNLHEPARVRRGKVASNSAKKSVPTRKSSVVR
FT                   KS"
FT   CDS             <9328. .10812
FT                   /codon_start=1
FT                   /product="p1b"
FT                   /note="RNA-dependent RNA polymerase; contains RdRp motif;
FT                   p1b is expressed as a ribosomal fusion protein with p1a"
FT                   /protein_id="ACH79941.1"
FT                   /translation="GTLHPLIRVIYTNRLAFGVVRSQAIPPRKASLQENLLSYESRNYN
FT                   FIKTERFVGPENFGKVMAAAVIERCFRMDEVAKIRSDIIALTEANIQKWLDKRTPCQVK
FT                   SVQAELKLPFAVEEQITNYKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIYSPC
FT                   FDEFKNRVLSSLNGNIVFFTEMTNAGLAEVIRRIIGDDDNLFVGEVDFSKFDKSQDLFV
FT                   KEYERALYSEFGFDDELLDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLV
FT                   TLGILSLYYDVSKFELLLISGDDSLIYSKEKISNFSSEICLETGFETKFMSPSVPYFCS
FT                   KFVVQTGNKTCFVPDPYKLLVKLGAPQYKLTDDELFELFTSFKDITQDFGDQVVLEKLK
FT                   LLVETKYGFTSGTTMPALCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLI
FT                   CERVVYDNRVGYFSYFDNPFAKPDASDGQADDLATG"
FT   CDS             10861. .11772
FT                   /codon_start=1
FT                   /product="p33"
FT                   /protein_id="ACH79942.1"
FT                   /translation="MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDR
FT                   DPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHIDNQPNREGNVTYVKT
FT                   VDKSRFVIRIRAMPASMRGHYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENL
FT                   NKVCSSSFFFRAVSETATNEFSVVTDDVEDVKYVRKRAEGFSHCADPYPPRCYRNANLG
FT                   DSSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLTIIFV"
FT   CDS             11842. .11997
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="ACH79943.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNASPY
FT                   GTHATI"
FT   CDS             12003. .13787
FT                   /codon_start=1
FT                   /product="p65"
FT                   /note="HSP70 homolog"
FT                   /protein_id="ACH79944.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGIKSMP
FT                   VPYLSPLNNDLGLSVALPSLIALYTKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYTCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFLPQKELNVSSLKEALSLQTDPVKYTVTHYG
FT                   MSETVSIDQTTLREIASVFITRTIDILTQVKAKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LKTVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKRERFLLRTLFDTLLADLRKTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERVPL"
FT   CDS             13711. .15321
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="ACH79945.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGVEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSTDVTAVEHSWCLSNSCGKLLSSTEVDAYKTMVFT
FT                   KTFDSGVFGVTTKLETYLSYCISLYKKHCMKDDDYYNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   TLIPFDPTDFVLDIPKLNIHDTMVVVGNQIRHLEHVVESDALDDLSQHVDLNLAADNPD
FT                   LRVDLRWAGMFVYYGIYRCAADRVVERPALFNLPQKLLSQDDGESCLLRMSSVETLFNL
FT                   VQKVNKDINIRRQFMGRHSKVALRLYRNLGLKFPPISSVRLPAHHGYLYVDFYKRIPDN
FT                   AVDADELESLRQLRSSVDVMCKDRVSITPPPFNRHRRGSSRILRGRGARGASSRYMSRD
FT                   VATTGFNLPFHYGRLHDAS"
FT   CDS             15296. .16018
FT                   /codon_start=1
FT                   /product="p27"
FT                   /note="minor CP"
FT                   /protein_id="ACH79946.1"
FT                   /translation="MAGYTMLPKTDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIES
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CTARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16110. .16781
FT                   /codon_start=1
FT                   /product="p25"
FT                   /note="CP"
FT                   /protein_id="ACH79947.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RRLGTQQNAALNRDLFLTLKEKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16747. .17250
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="ACH79948.1"
FT                   /translation="MSGSLGNLTRVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSE
FT                   DVLNSFSAISNCTIIADGSALLKDNTVVDHLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAISSDRVLFKVIIGTNVDDSRCGCSIWFYDNGMFQNGLTRCNNLVAL
FT                   FSAT"
FT   CDS             17284. .17643
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="ACH79949.1"
FT                   /translation="MSIRRVWLKVMAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYELANFDLDFLRIVIIPLSGGAVNESRADRANVSEIVESHMSDRDRMNILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17719. .18267
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="ACH79950.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   TMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRTHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDISLVSPSCV"
FT   CDS             18349. .18978
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="ACH79951.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEVKTVSLEADRLEFLRKMNPFI
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPNINAIDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 19251 BP; 4742 A; 3777 C; 4911 G; 5821 T; 0 other;

eu937519 Length: 19251  26-NOV-2008  Type: N  Check: 7461  ..

       1  aaatttctca aattcacccg taccctccgg aaatcacgtc cggacgctgc
      51  gggaatcggt gtaaatcccg gcaaattgcc cactacgccc atacaaacaa
     101  atataacatg tcgaaactcg gagctcgctt caagtccttg actttcgctg
     151  tacgcagcga ttacatcatc tcgcgcatct ggcgcgcctt taacaccgtt
     201  ggagtcctgc acttcttcgg tactgaaaca accaccaagg tggttaagga
     251  attttcggct cctcagccga tagtccctct acggaaatcc tgttttccgt
     301  tttctgttcg cgctgctgtt cgcgcgatta aagctgccgg acgtcccatt
     351  gacgctccgc gctctggatg cctctgtggc ctccctgtta tcgacacatc
     401  tggtgtcgta cgtccccgct ctgtcgcggg catttggagg tattctctgt
     451  gtaaacctcc ccttactgcc gccgccaaga agtccattcg caaggcgaag
     501  aaagattctg ctttctttct tagccgggct tcttcactct tctcacggga
     551  agtcccctgc ggcacgcgtc atagacttcg taggcgcgtt atgaaacgag
     601  tagaccctac catgcacgag agtccccaag acgagatcaa acttaaggga
     651  cgccgacatg gcaagaattc tgacctcccg tatatggggg aagcggcgtt
     701  ggatgatatc cttcgctgga ttgagggggt aaatcccccg ccgtcgatgg
     751  tcgccattcc ggtgcccatc tctttcggcg ccgtgcccac aacggcatgg
     801  tgctctcctg ctgacgcggc tgttttgcgg tgtcgtttag actaccacgc
     851  cgctgagact tcctttcgtg acgaaaggaa gcacgtgaga tacgtctata
     901  atgacgtgtc ttctgctgcc aaccgtcctc gtacggtttc tccccgcaag
     951  tgcgggcgtg ttttccccag cggttctgcg ctgggtgttg aggtcccgag
    1001  cactagggat cgccataccg ctttcgtgag atctactcac gctagcgttt
    1051  tcttctccga cgcggttcgc cgcgttcgca tgttccgtcc tgggcggaat
    1101  aatttcttca ctagcgtcgt tagtgggcgg cgcgttagtt actttagacc
    1151  cggacctaat ggtacggtgt ctgttttaat gtcggacggt gtcaacacgg
    1201  cacgtctcga cgttgttgct cctgcgtact atgcgtacgc taaagcgtta
    1251  ggcgccaaag tgcgctgttt gtgggagtcg tccgatttgg acgatgctaa
    1301  gatacgtgac ggccagtgct acgttcgtca cgtatacgac gtggcccttt
    1351  acttcggaag gcgcgtcgat ctttctgtgc gccgaacttt gggtttgttt
    1401  cccacagtgg gtgcactaaa agcttatctt gttcgcgagt acggtcgcga
    1451  atctttgaag gttccgatgc gcgggactta cacttttggc agtgtgtttc
    1501  attgcctgtc gactaaatct tttgtcgact tgagatctat tcctaaccat
    1551  cacttggttg gtggtgcgtc tgctcatgtg tttattgggc agattcgtgt
    1601  tgacgttcct ggtggtgtct ctaagccatc acgagcagct gttcgcaggc
    1651  gtaataggcg tttgcgtgaa gacgggtttt taggtagtac cgattcgtct
    1701  tcttcaggag ggtcgagata ctgttcggat tgttcaactc ctcgcagtcc
    1751  accctctccg tcgattgttg gaccaactct tggccggata ccaagtataa
    1801  accggaagtt ccggtttcca gcaggcactc agttgagtgt ttctatccct
    1851  aaacgcaatg atgatcgcgt gtacgtgtcg gtcggccaag actttgatga
    1901  gttgtgccat gccgtgtgta cctacgttaa gaggtacaac tcgagaaaag
    1951  cattttacac gcggtttgaa aatggtgatg atttcgccgt cattcggcgt
    2001  gcttccgtcg gaggtcttca cgtgttcgtg aaacgcggta actttacggc
    2051  tcggttccct atgtcggctt caaggtatga gcatcattat gatgcaagta
    2101  tgaaaggcgc cggtttgtcg tgggtgcgga agagtcggtt tccgaatgtt
    2151  gaagttatac gccgtcgaag gagtcggacg ggcggttctt tggctagctt
    2201  tccggacgcg aatttacgga ttaattctga ccaaccgtcg gattctgttc
    2251  aggcagttcc ggtgtcgggt gagaattctc catcgtctcg aggagcgtct
    2301  tcgccccgac gtgatcctgt tgaagggtcg ggctggtata aggtgggttc
    2351  tcctagtcat cactcgagtg ccgctcgtgg gcaacgttcc actgaacgtg
    2401  ggaagattgg ggatttcagt tttccgagta gcaccgtgta taatgcacat
    2451  gtagacgagc atgcttataa acgtgtgttg aaattgcggg acacgtcggc
    2501  gtcctctttt cttcgtatag ttttggctcg tttgtcgagt tatcggcctc
    2551  ttagtgacga gttctttaac aagtgcgtta cttctcggtt cgtagcttgt
    2601  atcgaggcgg ttgaatcggg tctcgttaca gtacactttc gatccgacgt
    2651  gtttcgcgcc tcgttcccgt ttggcgttta tttgtatact cgtcacgcgt
    2701  ttgatattta cagtggtaag ctcctgcaac tagatagcta cgggttctcg
    2751  gaagacctga aggacggtta ctgctatatt cgtcatatcg ctgaggtctg
    2801  tttgagtatg ggaaaagttt tctttaggag ggacgttaac ttaggggcgt
    2851  tcccttatgt tttcgaggta cagcaccgtc ttgagcggtt gtacggtaag
    2901  cgggctgttg aatacggcgt tagaggatat ttttcagcaa cgcgtcttta
    2951  ccactgttgc tttaccgatt cgccgagacc cttcaaatct ttaaataagt
    3001  atcataagat gggtggtgaa gaaggtgcgt tattaatcac tgacactgat
    3051  agattacgtg ccgtggggag tgcttacgaa aaggtgaagg ggcgtttgcc
    3101  tgattcttta cttgttcgat cggtggagaa agatttgata gaattcaatc
    3151  aaactctggt tgatacgcaa cgggctagac ctggtgttgc agtacctttt
    3201  cagatgagtg agaaccaaca ggtgatgctc actagagctt atcctgagtt
    3251  taatataaac tttactcatt ccgtacactc cgatcacccc gtggctgcgg
    3301  gttctagaat gttagagaat caccttgttc gtaaatacgc aggtagcgat
    3351  tattcggacg taggtggttg cccattattt catttacgtg cgggtcatac
    3401  aggagttcac gtttgcagac cagtgtacga tattaaagac gcccaccgta
    3451  gagtcgttcg tcatcatcaa cttagtaaag tagcttttga tcacactgac
    3501  gggtctaagc aggttggtgc tgtcaatacg aacaccgtgt gtggtaacgt
    3551  tttaggggag tgttttcatg cgtctgatgc gattgttatg gtgcaagttt
    3601  atgacgtgcc attgcgagag ttgtgtagag ctatggtgaa caagaaagct
    3651  tcggtgtgtt atatgaccgt ggttacgcct ggtgagctgt tggacgcccg
    3701  tgagtccttc ttcatcaaag agttagactg ttcggtggag ttggacgctg
    3751  tcgccgatag ggttatctac tgttttaaca attcagcgta tacgcacacc
    3801  tattctacga tatgcgaata catgcgtact ccttgtgtgg tggtggatgg
    3851  ttttctgttc actatagaga tggtttcact cagatgcagc gttaactatt
    3901  attgtatcac caagtcgcgg gtttgtccga gaatcagcga gattaaacgg
    3951  ttacgctatc gtcggtgtga tagtgacttg atcaggatca agattcctcg
    4001  gtactctaat aagactcgta gttgtttacc agggtgttat tatttgtatt
    4051  tagacgctaa gttcgtgagt cgtgtgtacg aatacgtggt taataattgt
    4101  gttgtggtga atgctaagac ttttgaatgg acttggaact acatcaagtc
    4151  ctgtaagtca agagtggtca tcagtgggaa gatcatccat agggacgttc
    4201  ctattgcgtt ggagtatttg gatgggtttt ccgcagttat gttgtccgcg
    4251  ggcgtgaaag gtaggcagaa cgcggaatcg ttttctaggc gtctagcggc
    4301  cttttcaggc gacacttctc ttttcgaatt ggtgaggttc gccatttcag
    4351  agaagtgtcg cgatttattt gtgggcgttc aggaggccgt agagagatac
    4401  gtgaaatcgt acctcagaaa ctcgtttaat ataagtttcg cggacttgtc
    4451  agatccgttg cttaccatta gtgagtattc ggagttagac gttcctatcg
    4501  atttgccggg ttttggctgc ataacggaag gagatgaggc taaactcata
    4551  gaagatgggg ttaagtcggc tttactgcga aaagcagttc gtgacgaggc
    4601  gcaactcatt ctcgaaaggg gcggtacgtc agagatcgtt ccttgtgggg
    4651  atgatgatgg tttaggcagc gacggttctg acagtttact cgggtccggt
    4701  agtgattcgt cttctaaagc cagttctggt ggtttgcggg ccggggccgc
    4751  cccttcactg ttcagaagct tgttgaagaa gttgggtggg ggtttttgta
    4801  tggccaagag gttattggac ttgttgtgcg agcgattagt tggttcgttg
    4851  tcgcgcttaa agttcggtac cactcattta acctcattct ttagcatgtt
    4901  acgcgctaag ctttcgcgta atttcttcga cgattcgatt tttaccgctg
    4951  tttgggacgt ggtgatgaat ttgattagaa tcgtcaacgg ggtgaccagg
    5001  acgaaattgg agtgttttcg caatgttctt cggttaattc ctacgttgtg
    5051  ttctggttgt aaggacttcg caaaagactt tgcaaacatg tgtaggttag
    5101  ttttgctatt ttctacggag ttcttcagta aaagctatgc taaactgtgt
    5151  cggtttagtt tggaagtatt cgatgtcgga ctcattgaga tttcagcgcg
    5201  taacatggga ctagagactt gtgtttcgat ggcttcagcc atttttgacg
    5251  tcgtacttac ctatcctctg ggaaatatta gctttcccgt cgtatgcgcg
    5301  agagtttttg gcgccctcgc tatggaagtg ggatcaaact attgttttaa
    5351  gaaaactttc ggcaaacctg aaattttagg agaggacgct tttcgtagaa
    5401  cggtaagtat ggtgttgagc gctaaggctt tcgacaaact gtcgatcgac
    5451  agtaagggtt tagttaggtg ttccggtgtt attcctggag ttttgaggat
    5501  agtgttttcg tctctgtttt ccgatgccga cgcgtgggtg ggttatagca
    5551  aacacgaagt ttcctcactt cccataatca cgtatagcgc gaaaaagtta
    5601  tctttcgcgt tggagcagac taaggaagcg tgcatcgcct ttataatcga
    5651  ttcgtctaag aggatcttag cgtctttgac ctcggagatt cacgagtctt
    5701  tccaaaattt ggaactaact aatggtgcta agtccttgta tggacatgtg
    5751  agttctgtac tctcagcgtc taatagtgtg gttagcaagg caggaaacgc
    5801  cgttgcagca gttaaagcgg cggggagtgg tcttagtaaa cgtgtgaggc
    5851  gcattcgtcc ttcttttcgc ctagctcggt gtgttaatga acagaccagc
    5901  gaatactatt ctgctagtga cgaatctgac ttggacgagt cgttgcttag
    5951  tgacacgccc ggtcttcgtg gtaacgggaa gtgtaacgat ttgtttcgtg
    6001  tcatttccgg acgtgtttcg gtatgttgta ggcgcgctgt agaagccttg
    6051  aagcgtttag tcctacacgt cggtgactgc ttgtactcgc gcattatgga
    6101  ctcttttgtg aggttatttg ttgaaaccaa tgttgcagtc gggaagtgtg
    6151  aatctttcgt cgtcgactgt acccgaaaaa tttctgattt agtaatcggg
    6201  tatattactt ggcgcaatct tcattccggt gcgtactcga cgactccagg
    6251  gttatctggt ggtagtagga gttctctttc caggttcttg gatggtggtc
    6301  tcacgtgtgt aattcgaagt attgttaccg cgtggttgac ggttttcgat
    6351  gagacctttt atttgagtct agtccatcgg atgaggactg cctcgataaa
    6401  tgtgttgtta gaattcttga agaacctccc ggtttgttta gtttcgatat
    6451  acactttcat agagtgtaga tctaggattt tccctttgaa ggaatttctt
    6501  tggggctttt gcgtttttgt ttggaacatt gttaaggaac tttccatatg
    6551  catttacgga agtctccccg tttgcgttac gaggttgtgt aatagggcgt
    6601  tccgtcgcgg ttccaacgaa ggtgacgtgc gtacgcttca agtgatcacc
    6651  gaagccgaaa accgaatcga gtttttgcga gaagttctcg ccgaaatggc
    6701  acggtatcgt gcttctctcg agatacccgt accagggtcg cctgatagtc
    6751  ctttgtttcc accaacgtac ggcgagattg aggagttagg taacgattcc
    6801  tctgacagtg cccgattgat aggtgtggac aatggtttag attcagtgcc
    6851  cactgaaagc gaagcagaac tagattcgga tggtgatagc gacgactcaa
    6901  tacctttgga tcgcgacttt gagcaaatcg gaggtcttgg cggaagcggt
    6951  aacgttgacg tctttcgttt agggctgaag ttcgtgtgga ggatgttgcg
    7001  taatttgttt aacttaagag ccgttaaatt ctcctatggg ttagctcttc
    7051  agtgtatatt taacggcggt tcaatgggcc agtttacgtc gcgactgtta
    7101  ttcagtttcg gcaactgctt accgtttgag ctctttagac atgtttgtag
    7151  tgtgaggtgg ctgtcaaaga gcttagcaat acgtgttcgt aacgctagta
    7201  tttgtgacga agaaacggtc gaacgtttct tcagtttttc gcgatttttg
    7251  tacgattcgc gttacttatc ggacgtgttt tcggtgttgg agagggtcga
    7301  tttttactta agttatctat tctcgttgcc gaagaggtgt ctcacgcgta
    7351  accgtagtgt ccgagtttgc gctcgagcgc cagttcgcgt gattagggac
    7401  atgggacttg tggaagacgg caagaagtct ttaaccgaag tgttgaactc
    7451  tttggactca ttgaaagtgt ccgaccgtaa agggaagtca gcacttattg
    7501  aaagtgatgg ttccgactcc gagagcggtc attcattcgg ttccatttca
    7551  ttcggatcgg ttaatgagga agttttagaa gcagtgaacg gtggtgtcgt
    7601  atccgaaaaa gctccactga tgaagcatgc ggatgcacta agcaggttgg
    7651  agccagacct tagtggtaaa aaggatcttc ctattgtcag gagaagtttt
    7701  acccgcggtg aatcttcagg tacgaaaccg gcaggaagct tgtgcgtgta
    7751  cttaacgacg ttgaattctt cattcggttc ggtgcctgac ctgtatcccg
    7801  tcgcacgtga cataacgtac aagaagatga ccaatgccat gcgcgagttt
    7851  tattactcgc aaaaggtaac gttgtacgaa cttcatggaa aattgagctc
    7901  gtactgggat gaattgaaga cggtaggttt taataggaag ttggcgaaga
    7951  tggatttaga cgatgacgtt gatgtcgtcg attttaactt gaaggtaata
    8001  gtggggaggc atggtacccg tcctttcaga aatactgtga actctcacga
    8051  gttcatgttt tgtgatgacg ggttggtgct ttgcccggga ccgaaaaaac
    8101  gtgactttgc tctgatctct agtcaaacgc aattcgttgc tgcgaactca
    8151  ttcttgcgtg ccgtggacgg taaagatttg acgttcacta attcggagca
    8201  tagtctcata gtttatgagg ctcctcccgg tggtggaaag acgcattctt
    8251  tggtaacgta tttcgccgat tattgtacca aagtgtcttg cttggtggtg
    8301  accgctaaca aaaattcgca agcggagatt tctcaaagaa tctctagaga
    8351  gttaatggat agaaagatgc ttgctaaaca cgttgttaaa accgccggta
    8401  gagtgttcac tgtggactct tatctgatga accatattcg actcaagact
    8451  gatttgttgt ttgtcgatga gtgttttatg gttcatgctg gagcaatcgg
    8501  agcggttgtt gagttcactt catgtaaggc tgtggttttc ttcggtgata
    8551  gtagacaaat tcattatatt caccggaacg attttggtgt ttcattgttg
    8601  catgacatag acgcatttat agagccacag caccgcattt acggtgaggt
    8651  gtcctacagg tgtccttggg acatctgtga gtggttgtct aaattctatc
    8701  cgagacatgt ggccactgct aacactggta gtatcgggaa atcgagtgtg
    8751  tctatagaga taattaatgg gtgtgacgat gttccttacg atagtagcgc
    8801  gaagtacatc gtttacacac aagcagaaaa gaacgaactg caaaagcacc
    8851  ttggtcgttt aaccgtaggc cgaactaaag cggtgcctat tgtgaacaca
    8901  gtgcatgaag ttcaaggtga aacatataag aaggttcgtt tggtaaggtg
    8951  caaataccaa gaggacactc ctttctgttc agataatcat gttgttgtgg
    9001  ctttaaccag gcacgtcgac tccttaactt actccgtttt gaatagcagg
    9051  agatacgaca agaccgcttc cagtatagat gaagcgaggg agatttttga
    9101  caaatttcgt tcgacgaacc attctcacgg ttcttcgacg ttggaatggt
    9151  accttgagaa ataccctact gaatataagg gtagtaaagc atcttcggcg
    9201  ccattaagtt gtattaatga gtttcttaac gaggtcgttg tcggttcttc
    9251  agttgtgcag ttgggagata cttcagaaga attaagttct cgtccttttg
    9301  agtctggatg tgacaatatt accgtaaggg acactgcacc ccctgattcg
    9351  ggtaatctac acgaaccggc tcgcgttcgg cgtggtaagg tcgcaagcaa
    9401  ttccgccaag aaaagcgtcc ctacaagaaa atcttctgtc gtacgaaagt
    9451  cgtaattaca actttataaa gacggagcga tttgtggggc ccgaaaattt
    9501  cggcaaagtc atggctgcgg ctgttattga gaggtgtttt aggatggacg
    9551  aagtggccaa gataagaagt gatattattg ctttgactga agccaatatt
    9601  caaaagtggc tcgataaacg tactccgtgt caggtaaaat ctgtgcaggc
    9651  cgaattgaag ttaccgtttg ctgtggaaga gcaaatcacc aactacaaac
    9701  taatggttaa gcgtgatgcc aaagtaaagc tcgatgattc gagtctgtcc
    9751  aagcaccctg ccgcacagaa tattatgttt cataagaagt ttattaatgc
    9801  tatttattct ccatgcttcg acgaatttaa gaatagggtg ttgtcgtcac
    9851  taaacggtaa tatagtgttc tttaccgaaa tgacgaacgc tggattggcg
    9901  gaagtcatta gaaggattat aggtgatgac gataatcttt tcgttgggga
    9951  agtggatttc agtaagttcg ataagtctca agatttgttt gttaaggagt
   10001  acgagcgtgc gttatattct gagttcggat ttgatgacga acttctcgac
   10051  gtgtggatgg aaggcgaata ccgcgctagg gctaccacgt tagacggtca
   10101  actgagtttt tcggtcgacg gtcaacgtcg ttcgggaggt tcgaacacat
   10151  ggattgggaa ctctttggtt accctgggta tcctatcctt gtattatgac
   10201  gtctcaaagt tcgagctact gcttatatct ggtgacgact ctctgatcta
   10251  ttcaaaagaa aagattagta acttttcttc agaaatttgt ctggagacag
   10301  gttttgaaac taagtttatg tctcctagcg taccatactt ttgttcgaag
   10351  tttgtggttc agacagggaa caaaacgtgt tttgtaccgg acccttacaa
   10401  gttgttggtt aaactggggg ctccccaata caaattgact gatgacgaac
   10451  tcttcgaatt gttcacttcc tttaaagaca tcactcagga ctttggtgat
   10501  caggtggtcc tagagaaatt gaagttgtta gtagagacta agtacggctt
   10551  tactagcgga actactatgc ccgctctatg tgctatacat tgtgtacggt
   10601  ctaattattt gtcttttgaa aggttgtttc cctttattag aggttggtat
   10651  gttgttgacg ctttgaagct tagacaactg aggaaattcg ccaatttgat
   10701  ctgtgaacgt gtggtttacg ataatcgcgt gggttatttt tcgtactttg
   10751  acaatccgtt tgctaaaccc gacgctagcg atggtcaagc cgatgactta
   10801  gcgacaggct gatagtttgt tcagttctcg ctgagagcta acacaggtag
   10851  ttgagtcgag atgtttgcct tcgcgagcga aaaccaagac atattagaag
   10901  aaaagatttt tcgccgtaga acctgccatc gtaagtattt ggatgacgtg
   10951  gttagggact ttaccattga tattggttat gatactgtcg atcgtgatcc
   11001  tacggtattg gctgattatt tctcgttgta tttctttttg cttaacaatg
   11051  ataacattgg gcctttagca gcttcgatta tagtaagccc accagtaagc
   11101  gggactcata aaattcgagc gcacatcgat aatcaaccga atcgtgaagg
   11151  aaacgttact tacgttaaga ctgttgataa gagtcgtttt gtgattcgca
   11201  taagagcgat gccagcttct atgagaggcc actactcctt tcgggcgttt
   11251  gttagtggtg acgtcgctag cgaacgtagt gagtttatat gcagttttgt
   11301  tggtagtagg tttctttgtt gttgcacaca aacaatatcc gaaaatttga
   11351  acaaggtttg ttcgtcttcc ttcttcttta gagctgtttc ggaaactgct
   11401  actaatgagt tttctgttgt gactgatgat gtagaagacg ttaagtacgt
   11451  aagaaagcga gccgagggtt tttcacattg cgctgacccg tatccaccta
   11501  ggtgttatcg taacgctaat ttaggtgata gttcaggggt ccaaagtcgc
   11551  acgattgaag aggaaggtta taggacggac actgtaggta acgtcgcggt
   11601  taccgttccg aacactccac tcgttaatgc cgtctctccg tatgtcgcgg
   11651  agtacaacga aaatacgcgt tcgcgtatct cgttaatacg gcgagtctgc
   11701  tgttacgccg tctgtgtttt agtggtttct cttcttataa tgagcggttt
   11751  gttgactatc atattcgtat gacttggtgt agtaacttat ggggtatggt
   11801  tagctaaaac tcaccgtttg actctgttta aacggggttc aatggactgt
   11851  gtaattcaag gatttttgac ttttctagtt ggtatagctg tgttttcggc
   11901  ttttgccgga ctaattatca ttgttataac gatttatcgg tgcacgacta
   11951  agcccgttag aaacgcctct ccttacggca ctcacgccac tatttaagcg
   12001  gtatggtgct tctgggttta gactttggta ccacgttttc gacggtggct
   12051  atggctacat cttctgagtt agtaatactt aaacaatcca attcgtcgta
   12101  catacctacg tgtttgtttc tgcatgcaga tcctaacagc gtgtcttatg
   12151  gttacgatgc ggagtactta gcggcttcgg gggaacctgg ctcgttttac
   12201  aaagatttga aacggtgggt cggttgtact gagaagaact accaaagtta
   12251  tttgcacaag ttatcacctt cctataaggt gatagtaaaa gagttcggaa
   12301  ttaagagtat gccggttccg tatttgtcac ctcttaataa tgatcttggg
   12351  ctcagtgtcg ctttgccttc tttgatcgct ttatatacca aatcgatttt
   12401  atcggatgcg gagagagtgt tcaacgtgag ttgcactgga gttatatgtt
   12451  cggtacctgc tggttataac acgttacaac gagcttttac acaacaaagt
   12501  gtgtccttgt cgggttatac ttgcgtgtac attattaatg aaccttccgc
   12551  tgccgcttac tccactttac ctaagttgag ttcggcggat aagtacttgg
   12601  ccgtttacga cttcggcggt gggacctttg atgtttctat agttagtgtt
   12651  aggttaccca cgttcgccgt tagaagttcg ggtggtgata tgaacttagg
   12701  cggtagagac atcgatagaa agttatctga taaaatatat gagttggctg
   12751  attttttacc gcaaaaagaa ctgaacgttt ccagtttaaa ggaagcttta
   12801  tctcttcaaa cagatccagt caagtatact gtaactcatt acgggatgag
   12851  tgaaaccgta tcaatcgatc aaacgacgtt gagggagata gcttcggtat
   12901  ttataactcg aacgatagac atacttacac aagttaaagc taagtctagt
   12951  atgcccgagt cgcaaagttt gaagctagtg gtagtcggtg gaagctcgta
   13001  cctaccaggg ttgttggata ctttgaaaac tgtacctttt gtgtctggga
   13051  tagtaccagt ggaagacgca agaaccgccg ttgctagggg gtgcgcttta
   13101  tatagcgagt gtttggatgg taggtccaag gccttactaa tagattgcat
   13151  tacgcatcat ttgtcggtta cgacatttag cgcagactcg gttgttgttg
   13201  ctgcggccgg aagtccaatt ccttttgaag gagaacgcaa actcacgttg
   13251  cgtaagtgtg ttagtacatc gaattatcaa gcaaggatgt tcgaaggaga
   13301  ttacgaaaaa gtttttcgaa acgaacgtat atacgcagct tcggtgtcat
   13351  tgtttacttt gggagttaac tggcgcgtgc ctaacgacgt tgagatgact
   13401  ctcgtgacca aagtggactc aatgggtaaa gtggaattct accttaaagg
   13451  tccatctggt gaattagtta acgtgcaagg tacttcacat tatgattatg
   13501  ttggtatgcc tcatcccact agaaagttgt tgaggcttag cgattacaat
   13551  gtaaactccg ccgctttagt tttagctttg acattgactc gcgaaaaacg
   13601  agaaagattt cttttgcgaa ctttatttga tactttacta gcggacttgc
   13651  gaaagaccgc aagtttaagc gaatattcta agaaatatcc gattactcga
   13701  aacgacattg atgtcgtctc atcacgtatg gggatcgttg tttcgaaagt
   13751  tttacgggga agcgatttgg aaagagtacc tctctgaatc aactcgaaat
   13801  ttcgacgaga gaaacgtatc gttagaccac actctaagtt cgggtgtggt
   13851  cgtccgtagg cagagtcttt tgaacgcgcc tcaaggaact ttcgagaatg
   13901  agttagcgct attatacaat tcggtggtaa ttaacgattt tgttgaatta
   13951  actggtatgc cgttgaagtc tttgatgaca ggtgttgagg accgtaaggt
   14001  acctgacgag ttaatatccg ttgacccgca tgaagttggg tgtagattca
   14051  cgttgaatga tgtagaatca tatttaataa gcaggggcga ggattccact
   14101  gatgtaacag cggttgagca ctcgtggtgt ttgagcaatt cttgtggtaa
   14151  attgttaagt tcgaccgaag tagatgctta caaaaccatg gtgtttacta
   14201  agacttttga tagtggtgta ttcggggtga ccactaaatt agagacgtat
   14251  ctatcgtatt gcatatcgtt gtacaagaaa cattgtatga aagacgatga
   14301  ctactataac cttatattac ctatgtttaa ttgtttgatg aaagtgctgg
   14351  cgtcgcttgg tttgttttac gaaaaacata ctgacaatcc gctgctgacc
   14401  ggcatgctca tagagttttg cctagagaat aaggtgtatt actctacttt
   14451  taaagtaaat ttggacaacg ttaggctgtt taagtctaaa gtgttgcctg
   14501  tggtgttaac agtctgggat atatctgagc ctgatgaccc ggtggatgag
   14551  agaacgctaa ttcctttcga ccctacggat ttcgtgcttg atatacccaa
   14601  actgaatata cacgacacta tggtggtggt gggtaatcaa atcagacact
   14651  tagagcacgt ggttgagagc gatgcattag acgacttgtc tcaacatgtt
   14701  gacttgaatt tagcagcgga caatcccgat ctacgtgttg atttgcgttg
   14751  ggcagggatg tttgtgtatt acggcatata tcggtgtgct gcagatagag
   14801  tggtggaacg accggcatta tttaatctac cgcagaagtt gttgagtcaa
   14851  gacgacggtg aatcatgctt gttgcgtatg agttccgttg aaaccttatt
   14901  caatctggtg caaaaggtga ataaggacat aaatattagg cgtcaattca
   14951  tgggacgtca tagtaaagtg gctttgcggt tgtatcgcaa tttaggtttg
   15001  aagtttcctc caatttcctc agttaggttg ccagctcatc acggctactt
   15051  atacgtcgat ttttacaaaa gaatacctga taatgctgtt gacgccgacg
   15101  aacttgaaag tttacgtcaa ttacgttcgt ccgtagacgt tatgtgtaag
   15151  gacagagtgt caatcacgcc tccaccgttt aatcgacata gaaggggttc
   15201  ttctagaata cttagaggtc gaggcgcacg cggtgcgagc tcgcgttata
   15251  tgagcagaga cgtggcaact accggtttta acttaccctt tcattatggc
   15301  aggttacacg atgcttccta aaactgatga caaagaaatg gatccggtga
   15351  gtgccgctgt gcccggtaaa tacccggacg ttattgaaaa atttgtgacc
   15401  aacaggtcag tagatgcgtt aatagaaagc gttattagca agttggatac
   15451  taattcaata tacgaagatt ccactgaaaa atttactggt gagcaactga
   15501  agtacgtcat ggttactatg gacactttct tactagaaaa ttacaaaacg
   15551  aaaacggaag atctgctggt tcacttggct atgattcaaa agaggttgtg
   15601  cactatatct acgagtacta aaaccaagtt tcgtgataaa ggttgtatca
   15651  gttatgtaca agggggttta cgatataagt taatggataa ggtagttttt
   15701  ccctttatta tatctaagtt tactgacagg gagactccaa acgctctacg
   15751  taagtatgct tgtacttttg aggagttaca cttgtgcacg gctaggttga
   15801  gacccgactt gtacgaaaac aaaaggacga ccaaagctgg gactccgcat
   15851  ttaaagggct acttatcagc cgactttctt acgggttccc tcccaggata
   15901  ttccgaacat gaacggggta tcattcttcg agcgtcagaa tctatgttag
   15951  ctagacgtca aggttatgag gaagcgaccg agcttcttaa cttacgcgat
   16001  ttaggaaagt atttgtagtt tgtttgcgga cggtggtatt acgccatccc
   16051  atgagcactg ctttaagggt cgttaattga cgactcttga tatttactaa
   16101  gtttgagtta tggacgacga gacaaagaaa ttgaagaaca aaaacaagga
   16151  aacgaaagaa ggcgacaatg ttgttgcagc ggagtcttct ttcggttctg
   16201  taaacttaca catcgatccg actctgatag cgatgaacga tgtgcgtcgg
   16251  ttgggtaccc aacagaatgc cgctttgaac agagatttgt ttcttacttt
   16301  gaaagagaag tatcctaatt tgtctgataa agataaggac tttcacttag
   16351  ctatgatgtt gtatcgttta gcggttaaga gttcatcatt gcaaagcgat
   16401  gacgacacta cgggtataac gtacactcgg gagggcgtcg aagtggattt
   16451  gtctgacaaa ctttggactg acgtcgtgtt taattctaag ggtatcggta
   16501  accgtactaa cgcccttcga gtctggggta ggactaacga tgccctttat
   16551  ttagcctttt gtagacagaa tcgcaatttg agttatggcg gacgtccgct
   16601  agatgcaggg attccggccg ggtatcatta cctgtgtgca gatttcttga
   16651  ccggagctgg cttgactgat ttagagtgtg ctgtgtacat acaagctaaa
   16701  gaacaattgt tgaagaagcg aggggctgat gaagtcgtag ttaccaatgt
   16751  caggcagctt gggaaattta acacgcgttg atctattgcg ttctgattcc
   16801  cggtttctat cgggatggtg gagtttcatc gtgaacgtgg gtgatataat
   16851  cgttcggttc gcgttacacg ttcctagtga agatgtgctg aatagctttt
   16901  cagctatatc gaattgtacg atcatagcgg acggtagtgc tttactaaaa
   16951  gacaacactg tggttgacca tttagagagc atgaaccctt tggcttattt
   17001  gttaaaatta gcgaaaacga ctactactat ttgttttact atgtctaata
   17051  aggttctttt tggtactact aaatccgaac cgcttagttg tttagctatc
   17101  tcgtcggacc gagttttatt caaagttatt ataggtacta acgttgatga
   17151  ttctcgatgt ggctgcagta tttggtttta cgacaatggg atgtttcaaa
   17201  atgggttgac ccgttgtaat aatctcgtcg ctttgtttag cgcgacttag
   17251  acacgaagtg accgttcggg tttaattgct gcaatgagta ttcgacgtgt
   17301  gtggttaaag gtaatggctg taattacggt attgtggtat ggtaaagaac
   17351  cttccattag cgaaggttac aacgctctta tgaatgatga ctttaagttt
   17401  atcgatacgc atttttcaaa cgtctcttat gctaagaaat gttacgaatt
   17451  ggctaatttc gatttagact ttctacgcat cgttatcatt cccttaagtg
   17501  gtggtgcggt gaatgaatcg cgtgctgatc gcgctaacgt ttctgagatt
   17551  gtcgaatcgc atatgagcga tcgagacaga atgaatatct tattgcgtaa
   17601  taagcggatc cagattcctt cgctcttacc ttgcgataac tagagtctac
   17651  tcagtagtac gtctactagt ataacgtatt gaacacttta gtgaggagtt
   17701  ttgtttaaac caaacaatat gcgagcttac tttagtgtta acgattacat
   17751  aagccttttg gctaaggtcg gcgcagttgt ggaacgttta tgcgatccaa
   17801  gcgtaactct cacggaagtg atggacgaaa ttaatgattt taactcgttt
   17851  ctcgctttgg tacactctat gaagtcggac atgaacggcg atcatcagga
   17901  tggtcaccat gagatgggtg aacacaagtc tcgattgttg tgcaatatag
   17951  aagcgaaact gcgaatactt ctcgacatca taagacgtcg gtttactcgt
   18001  gacaagctac tctgtaccag cgcaacagat accatgggct tcttcgttat
   18051  gaggtacatg agttctagtc acaccagttt cgagtccgta atgcgaacgg
   18101  agctgaaatt agtggttaaa gcggtactgt cggatttatc ccgcacgcat
   18151  aaactagact ttagcgagcg agcctttgca gcttacggta tccttttaca
   18201  aaagggtact gtagcgactg tttgcggtca gtttgacatt agtttagttt
   18251  ctccatcttg cgtgtaggtt aatacgcttc tcagaacgtg tggttgtatt
   18301  aactaacttt aattcgaaca aattattgtt aagagtctgc gagttacgat
   18351  ggacgatact agcggacaaa ctttcatttc tgtgaacctt tctgacgaaa
   18401  gcaacacagc tagcactgaa gtcaaaaccg taagtttgga agcggatcgc
   18451  ttggaatttt tacggaaaat gaatcccttt attatcgacg ctttgatacg
   18501  gaaaaccagt tatcaaggtg ctcgctttcg cgcgagaata ataggagtgt
   18551  gcgtggattg tggtagaaaa cacgataagg catcgaggac tgaacgtaag
   18601  tgtaaagtca acaacacaca atctcagaac gaggtggcgc atatgttaat
   18651  gcacgatccc gtgaaatatt taaataaaag aaaagctaga gctttttcta
   18701  acgcagagat gtttgcgatc gatttggtta tgcataccaa agaaaggcaa
   18751  ttagcggttg atttggccgc tgaaagggag aagacgagat tggctcgtag
   18801  acacccgatg cgttctccgg aggaaactcc ggaacattat aagttcggta
   18851  tgactgctaa ggcaatgtta ccgaacatca acgctataga cgttggtgat
   18901  aacgaagaca cttcgtcgga atacccagtg agtctgagtg tttcaggcgg
   18951  agttctccgt gaacaccact tcatctgatt gaagtggacg gaataagttc
   19001  cttgcggaac tttatgtcgg gttggtaaaa acccttatga tggtgatgta
   19051  tcactagaca ataaccggat gggtaaagtc tttaaaatga tcgaggggaa
   19101  aattaaccat atcctctcgt tggtctaagc tcccacagag tggtagtggt
   19151  ctcaagtgag gcttaacgta tgcgtgaacc aaagaagttc tccttagagt
   19201  gtgtgttgtt taccaacaca ctgtccctat gggggggcca acataggtcc
   19251  a