Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain T30, complete genome.

ACC No: EU937520

Dated: 2008-09-10 | Length: 19260 | CRC: -1431991748

                
ID   EU937520; SV 1; linear; genomic RNA; STD; VRL; 19260 BP.
XX
AC   EU937520;
XX
DT   10-SEP-2008 (Rel. 97, Created)
DT   10-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Citrus tristeza virus strain T30, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19260
RX   PUBMED; 17878952.
RA   Weng Z., Barthelson R., Gowda S., Hilf M.E., Dawson W.O., Galbraith D.W.,
RA   Xiong Z.;
RT   "Persistent infection and promiscuous recombination of multiple genotypes
RT   of an RNA virus within a single host generate extensive diversity";
RL   (er) PLoS ONE 2 (9), E917 (2007)
XX
RN   [2]
RP   1-19260
RA   Weng Z., Yu Y., Gowda S., Galbraith D.W., Wing R.A., Dawson W.O., Xiong Z.;
RT   "High-throughput sequencing of an RNA virus complex revealed genome-wide,
RT   large scale recombination in a population of viral genomes";
RL   Unpublished.
XX
RN   [3]
RP   1-19260
RA   Xiong Z., Weng Z., Barthelson R., Gowda S., Hilf M.E., Dawson W.O.,
RA   Galbraith D.W.;
RT   ;
RL   Submitted (31-JUL-2008) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Sciences and BIO5 Institute, University of Arizona,
RL   Forbes 303, Tucson, AZ 85721, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19260
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus sinensis cv Hamlin"
FT                   /strain="T30"
FT                   /isolate="FS2-2"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Florida"
FT                   /collection_date="2004"
FT                   /note="contains three different CTV strains"
FT                   /db_xref="taxon:12162"
FT   CDS             110. .9457
FT                   /codon_start=1
FT                   /product="p1a"
FT                   /note="replication protein containing two protease domains,
FT                   one methyltransferase domain, and one helicase domain"
FT                   /protein_id="ACH79952.1"
FT                   /translation="MSKLGASFKSSTFAVRSDYIISRIWRAFNTVGVLHFFGTDTTTTV
FT                   VKEFSAAGPIVPLRKSCFPFSVRAAVRAIKAAGRPIDAPRSGCLCGLPVFDTSGVVRPR
FT                   SVAGAWRYALCKPPLTAAAKKSIRKAKKDSAFFLSRASSLFSREVPCGTRHRLRRRVAK
FT                   LVDPTVRESPQDKTKLKGRRYGKNSDLPYMGEAALDDILRWIEGVNPPPSMVAVPVPIS
FT                   FGTLPTTAWCSEADAAVLRCRLDYHAAATSFRNEGKHVRYVYNDVSSAANRPRTVSPRK
FT                   CGRIFPSGSALGVEVPSTRDRHTAFVRSTHASVFFSDAVRRVRMFRPGRNNFFTSVVSG
FT                   RRVSYFRPGPNGTVSVLMSDGVNTARLDVVAPAYYAYAKTLGARVRCLWESSDLDDAKV
FT                   RDGQCYIRHVYDVALYFGRRVDLSVRRTLGLFPTVGALKAYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTKSSVDLRSVPNHHLVGGESAHLFVGQIRLDVRGGVSKPSRSAVRRRNR
FT                   RLREDGFLGSTDSSSSGGSRYCSDCSTPRSPPSPSVVGPTLGRIPSVNRKFRFPAGTQL
FT                   SVSIPKRDDDRVYVSVGQDFDELCHAVCTYVKRYNSRKAFYTRFENGDDFAVIRRASVG
FT                   GLHVFVKRGSFTARFPMSASRYEHHYDASMKGAGLSWVRKSQFPNVEVIRRRRSRASGS
FT                   SASFPDANLQVSSDRPSESVQVVPMLDEGSSPPRGVPSPRRNPVEGSGWYSVGSPSRRS
FT                   STTRGQRSAERGKIGDFSFPSGTVYNARVDERAYKRVLKLRDTSASSFLRIVLARLSSY
FT                   RPLSDEFFNKCVTSRFVACIEAVESGLVTVHFRSDVFRASFPFGVYLYTRHAFDIYSGK
FT                   LLQLDSYGFSEDLRDGYCYIRHIAEVCLSMGKVFFRRDVNLGAFPYVFEVQHRLERLYG
FT                   KRAVEYSVRGYFSAPRLYHCCFTDSPRPFRFLNKYHRMGGEEGALLITDTDRLRAVGSV
FT                   YDKVKKALPDSLLVRSVEKDLIEFNQTLVDTQRARPGVAVPFQMSENQQVMLTRAYPEF
FT                   NINFTHSVHSDHPVAAGSRMLENHLVRKYAGSDYSDVGGCPLFHLRAGHTGVHVCRPVY
FT                   DVKDAHRRVVRHHQLGKVAFDHTDGSKQVGAVNTNTVCGNILGECFHASEAIVMVQVYD
FT                   VPLRELCRAMVNKKTSVCYMTMVTPGELLDARESFFIKELDCSVELDVVADRVVYCFNN
FT                   SAYTHAYSTIREYMRTPCVVVDGFLFTIEMVSLRCSVNYYCITKSRVCPRISEVKRLRY
FT                   RRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTW
FT                   NYIKSCKSRVVISGKVIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAFSGD
FT                   TSLFELVRFAVSEKCRDLFVGIQEAVERCVKSYLRNSFNMSFVDLSDPLLTISEYSELD
FT                   VPIDLPGFGCITEEDEAKLIEDGVKSALLRKAVRDEAQLILERGGTSEIVPCGDDDGLG
FT                   SDGSDSSLGSGSDSSSKASSGGLRAGAAPSLFRSLLKKLGGGFCVARRLLDLLCERLVG
FT                   SLSRLKFGTTHLTSFFSVLRAKLSCNFFDDSIFTTVWDTVMNLIRIVNGVTKTKLECFR
FT                   NVLRLIPKLCSGCKDFAKDFADMCKSVLLFSTEFFSKSYTKLCRFSLEIFDVGLIEISA
FT                   RNMGLETCVSMASAIFDVILTYPLGSISFPVVCARVFGALAMEVGSNYCFKKTLGKPEI
FT                   LGEDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGIIPGVLRIVFSSLFSDADAWVGYSK
FT                   HEVSSLPMITYSAKRLSFVLEQTKEACIAFIVDSSKRILASLTSEIHESLQNSELTSGA
FT                   KSLYGRVSSILSASNGMVNKAGNAVAAVKAAGSGLSKRVKRIRPSFHLTRCVNEQTSEY
FT                   YSASDDSELDESLLSDTPGLRGNGKCNDLFRVVSGRVLVYRRRAVEALKRLVLHVGECL
FT                   YSRIADSFVRLFVRTNTAVGKCESLAVDCATKITDLVVGYITWRNLHFGAYSTTPGLSG
FT                   GSRVSLSRLLGDGLTCVIQNFVTAWLTIFNETFYSSLAHRMRTASINVLLEFLKNLPVC
FT                   LVSIYTFIECRSRIFPLKEFLWGFCIFVWNIIKELSVCIYENLPVCVTRLCNRAFRRSS
FT                   NEDDERTLQVITEAENRIGFLREVLAEMARYRASLEIPVPGSPNSPLFPPTYGEIEELG
FT                   DGSSDSARVIGVDNGSDSMSTEGEAELDSDGDSDDSIPLDRDFEQIGGLGGSGNVDVFR
FT                   LGLRFVWRMSRNIFNLRAVKFSYGLALQCIFNGRSTGQFISRLLFSFGGCLPFEFFRHV
FT                   CAVRWLSRSLALHVRNASICDEETVEWLFNFSRFLYDSRYLSLVFSELERVEFYLSYLF
FT                   SLPKRCFTHNRSVQVCVRAPVRVVRDVGLVEDGRKSLSEVLNSLDSLKVSNRKGKSAVI
FT                   ESDSSDSESGSSSGSISFGSINEEVLKTANGSVVSEKASLMKHAAALSGLEPDLGGKKD
FT                   LPIIRRNFTRGESSGTKSVGSLCEYLTTLNSSFGSVPDLYPVARDITYKKMTNAMREFY
FT                   YSQKVTLYELHGKLSSYWDELKTVGFDRKLAKMDLDDDVGVVDFNLKVIVGRHGTRPFR
FT                   NTVNSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFLRAVDGKDLTFTNSEHSL
FT                   IVYEAPPGGGKTHSLVTYFADYCTKVSCLVVTANKNSQAEISQRISRELMDRKMLAKHV
FT                   IKTAGRVFTVDSYLMNHIRLKTDLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSRQI
FT                   HYIHRNDLGVSLLHDIDAFIEPQHRIYGEVSYRCPWDICEWLSKFYPRHVATANTGSVG
FT                   KSSVSIEVINGCDDVPYDSSAKYIVYTQAEKNELQKHLGRLTVGRTKAVPVVNTVHEVQ
FT                   GETYKKVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLTYSVLNSRRYDKTASSIDEARE
FT                   IFDKFRSTNHSHGSSTLEWYLEKYPTEYKGSKASSAPLSCINEFLNEVVVGSSVVQLGD
FT                   TSEELSSRPFESGCDNVTIRDTAPPDSGNLHEPARVRRSKVAGNSAKKSVPTRKSSVVR
FT                   KS"
FT   CDS             <9330. .10814
FT                   /codon_start=1
FT                   /product="p1b"
FT                   /note="RNA-dependent RNA polymerase; contains RdRp motif;
FT                   p1b is expressed as a ribosomal fusion protein with p1a"
FT                   /protein_id="ACH79953.1"
FT                   /translation="GTLLPQTLVIYTNRLVFGVVRSQAIPPRKASLQENLLSYESRNYN
FT                   FIKTERFVGPECFGRAMAAAVIERCFKMDEVAKIRSDIIALTEANIQKWLDKRTPCQVK
FT                   AVQAELKLPFAVEEQITNYKLMVKRDAKVKLDDSSLSQHPAAQNIMFHKKFINAIYSPC
FT                   FDEFKNRVLSSLNGNIVFFTEMTNAGLAEVIRRIIGDDDDLFVGEVDFSKFDKSQDLFI
FT                   KEYERALYFEFGFDDELLDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLV
FT                   TLGILSLYYDVSKFELLLISGDDSLIYSKEKISNFSSEICLETGFETKFMSPSVPYFCS
FT                   KFVVQTGNKTCFVPDPYKLLVKLGAPQYKLTDDELFELFTSFKDNTQDFGDQVVLEKLK
FT                   LLVEIKYGFTSGTTMPALCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLI
FT                   CERVVYDNRVGYFSYFDNTFTKPDASDGQMDDLMTG"
FT   CDS             10863. .11774
FT                   /codon_start=1
FT                   /product="p33"
FT                   /protein_id="ACH79954.1"
FT                   /translation="MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDLVDR
FT                   DPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKT
FT                   TDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENL
FT                   SKVCSSSFSFRAVSKTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLG
FT                   DSSGVQSRTIEEEGYRTDTAGNVAVSIPNTPLVNAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLAIIFI"
FT   CDS             11844. .11999
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="ACH79955.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNTSPY
FT                   GTHATV"
FT   CDS             12005. .13789
FT                   /codon_start=1
FT                   /product="p65"
FT                   /note="HSP70 homolog"
FT                   /protein_id="ACH79956.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTAKNYQTYLHKLSPSYKVTVEEFGTKSVP
FT                   VPYLSPLNNNLGLNVALPLLIASYAKCILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSISMSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDKKLSDKIYEMADFIPQKELNVSSLKEALSLQTDPVKYTVTHHG
FT                   MSETISIDQTALREIASVFINRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LATVPFVSGIVLVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPTDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYTGMPHPTRNLVKLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRRTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13713. .15320
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="ACH79957.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRSFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGIEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDAYKTLVFT
FT                   KNFDSNVSGVTTKLETYLSYCISLYKKHCMKDDDYFNLITPMFNCLVKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDIRLAADNPD
FT                   LRVDLRWAGMFVYYGVYRCAIDRVVERPALFRLPQKLLSQDDGESCSLRMSAVEALFNL
FT                   VQKVNRDINVRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPVHHGYLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGRLYNTS"
FT   CDS             15295. .16017
FT                   /codon_start=1
FT                   /product="p27"
FT                   /note="minor CP"
FT                   /protein_id="ACH79958.1"
FT                   /translation="MAGYTTLPNTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDAFLLENYKTKTEDLLVHLAMIQKRLYTT
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16117. .16788
FT                   /codon_start=1
FT                   /product="p25"
FT                   /note="CP"
FT                   /protein_id="ACH79959.1"
FT                   /translation="MDDETKKLKNKNKETKEGDEVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16754. .17257
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="ACH79960.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGANVDDSRCGCSIWFYNNGTFQNGLTRCNNLVTL
FT                   FSAT"
FT   CDS             17291. .17650
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="ACH79961.1"
FT                   /translation="MSIRRVWLKVIAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTANESRSDRTNVSEIVESHVSDRDRMHILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17726. .18274
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="ACH79962.1"
FT                   /translation="MRAYFSVNDYISLLAKVGSVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VVGFFVVRYMSSSHTSFETVMRTELKLVVKAVLSELSRTHKLDFSERAFTAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
FT   CDS             18357. .18986
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="ACH79963.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTKVENVKSEADRLEFLRKMNPFI
FT                   VDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVSYTKERQLAVDLAAEREKTRLARRHPIRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 19260 BP; 4719 A; 3838 C; 4912 G; 5791 T; 0 other;

eu937520 Length: 19260  10-SEP-2008  Type: N  Check: 1789  ..

       1  aattttcgat tcaaattcac ccgtacctcc ggagctcgat ccggaccctg
      51  cgggacttgg tgtaaatccc agccagacgg ttgctctacg cccataatat
     101  caatacaaca tgtcgaaact cggagctagc ttcaagtcct cgactttcgc
     151  tgtacgcagc gattacataa tttcgcgcat ctggcgcgcc tttaataccg
     201  ttggagtcct gcacttcttc ggcactgata caaccactac ggtggttaag
     251  gagttttcgg ctgctgggcc gatcgtccct ttacggaaat cctgttttcc
     301  gttctcagtt cgcgctgctg ttcgcgcgat taaagctgcc ggacgtccta
     351  ttgacgctcc gcgctccgga tgcctctgtg gcctccctgt tttcgacaca
     401  tctggtgtcg tgcgtccccg ctctgttgcg ggcgcttgga ggtatgctct
     451  gtgtaaacct ccccttactg ctgccgccaa gaagtccatt cgcaaggcga
     501  agaaagattc tgcattcttt ctcagccggg cttcttctct cttctctcgg
     551  gaagtccctt gcggcacgcg tcacagactt cgcaggcgtg ttgcgaaact
     601  agttgaccct actgtgcgtg aaagtcccca agacaagact aaacttaagg
     651  ggcgccgata tggcaaaaat tctgacctcc cgtatatggg ggaagcggcg
     701  ttggatgaca tccttcgctg gattgagggg gtaaatcctc cgccgtcgat
     751  ggtcgccgtt ccggtgccca tctcttttgg cactctgccc actacggctt
     801  ggtgctctga ggccgacgcc gctgttctgc ggtgtcgctt agactatcac
     851  gccgctgcga cttcctttcg taatgaaggg aagcacgtga gatacgtcta
     901  taatgacgtg tcttccgctg ccaaccgtcc tcgtacggtt tctccccgca
     951  agtgcgggcg tatttttccc agcggttctg cgctgggtgt tgaggttcca
    1001  agtactaggg accgccacac cgctttcgtg agatctactc acgctagcgt
    1051  tttcttttct gacgcggttc gccgcgttcg aatgttccgt cctgggcgga
    1101  ataatttctt tactagcgtc gtcagtgggc ggcgcgttag ttactttaga
    1151  cccggaccta acggtacggt gtctgttcta atgtcggatg gcgtcaatac
    1201  ggcgcgtctc gacgttgtcg ctcccgcgta ctatgcgtac gcaaaaacgt
    1251  tgggcgccag agtgcgctgt ttgtgggagt cgtccgattt ggacgatgct
    1301  aaagtacgtg acggtcaatg ctacattcgt cacgtgtacg acgtggccct
    1351  atattttggg aggcgcgtcg acctttctgt gcgccgcact ttgggtttat
    1401  tccccacagt gggtgcgtta aaggcttatc ttgttcgcga gtacggtcgc
    1451  gactctttga aggttccgat gcgcgggact tacacttttg gcagtgtatt
    1501  tcattgcctg tcgactaaat cttctgtcga cttaagatct gttcctaacc
    1551  atcacttggt tggtggtgag tctgctcact tgtttgttgg gcagattcgt
    1601  cttgatgtcc gtggtggcgt ctctaagcca tcacggtcgg cggttcgcag
    1651  gcgtaataga cgtttgcgtg aggacggttt tctaggtagt accgattcat
    1701  cttcttcagg agggtcgaga tactgttcag attgttcgac tcctcgcagt
    1751  ccaccctctc cgtcggttgt tgggccaact cttggtcgga taccgagtgt
    1801  aaaccggaaa ttccggtttc cagcaggcac tcagttgagc gtttctatcc
    1851  ctaaacgcga tgacgatcgc gtgtacgtgt cggttggtca agactttgat
    1901  gagttgtgcc atgccgtgtg tacctacgtt aagaggtaca attcgagaaa
    1951  agcgttctac acgcgttttg aaaacggtga cgattttgct gtcattcggc
    2001  gtgcttccgt cggaggtctt cacgtgttcg tgaaacgcgg tagttttacg
    2051  gctcgtttcc caatgtcggc ttcaaggtat gagcatcatt atgatgcaag
    2101  tatgaaaggc gccggtttgt cctgggtgcg gaagagtcaa tttccgaacg
    2151  ttgaagttat acgccgtcga aggagccggg caagcggttc ttcggctagt
    2201  tttccggacg cgaatttaca ggttagttca gaccgaccgt cggagtctgt
    2251  ccaagtggtt ccgatgttgg atgagggttc ttcaccacct cgaggagtgc
    2301  cctcgccccg acgcaatcct gtcgaagggt cgggctggta tagcgtgggt
    2351  tctcctagtc ggcgctcgag tactactcgt gggcaacgtt ccgctgaacg
    2401  tgggaagatt ggggatttca gttttccgag tggcactgtg tacaacgcac
    2451  gcgtggacga gcgtgcttat aaacgtgtct taaagttgcg ggacacgtcg
    2501  gcgtcctcct ttcttcgtat agttctcgct cgtttgtcga gttatcgacc
    2551  tcttagtgac gaattcttta acaaatgcgt tacttctcga tttgtagctt
    2601  gtatcgaggc ggttgaatca ggtctcgtta cagtacactt tcgatcagac
    2651  gtgtttcgtg cttctttccc ttttggtgtt tatttgtaca ctcgtcacgc
    2701  gtttgatatt tacagtggta agctcctgca attagacagc tacgggtttt
    2751  cagaagacct aagagacggc tactgttata ttcgtcacat tgctgaagtg
    2801  tgtttgagta tggggaaggt tttctttagg agggacgtta acttaggggc
    2851  gttcccttat gttttcgagg tacagcaccg tcttgagcgg ttgtatggta
    2901  agcgggctgt tgagtacagc gttagaggtt atttttcagc accgcgtctt
    2951  taccattgtt gctttaccga ttcgcctaga cccttcagat ttttaaataa
    3001  gtatcatagg atgggtggcg aagaaggtgc gttgttgatt actgacactg
    3051  acagattgcg tgccgtaggg agtgtttatg ataaggttaa gaaagctttg
    3101  cccgattctt tactcgttcg atcagtagag aaagatttga tagaattcaa
    3151  tcaaactctg gtcgatacgc aacgggctag acccggtgtt gcagtgcctt
    3201  ttcagatgag tgagaaccaa caggtgatgc tcactagagc ctatcctgag
    3251  tttaatataa actttactca ttccgtacac tccgatcatc ccgtggctgc
    3301  gggctccaga atgttagaga atcacctcgt tcgcaaatat gcaggcagtg
    3351  actattcgga cgtaggtggt tgcccactat ttcatttgcg tgcaggccac
    3401  acaggagttc acgtttgcag accggtgtac gatgttaaag acgcccaccg
    3451  tagagtcgtt cgtcatcatc aacttggtaa agtagccttc gatcatactg
    3501  acgggtctaa gcaggttggt gctgtcaata cgaatactgt gtgcggcaac
    3551  attttagggg agtgttttca tgcgtctgaa gcgattgtta tggtgcaggt
    3601  ttacgatgtg cccctgcgag agttgtgtag agctatggta aacaagaaaa
    3651  cttcggtgtg ttatatgacc atggtcacac ctggcgagtt gttggacgct
    3701  cgtgagtcct tcttcatcaa agagttggac tgttcggtag agttggacgt
    3751  tgtcgccgat agggttgttt actgctttaa caattcggcg tacacgcacg
    3801  cgtattctac gatacgcgaa tacatgcgta ctccttgtgt ggtggtggat
    3851  ggttttctat tcactataga gatggtttcg cttagatgca gcgttaatta
    3901  ttattgcatc accaaatcgc gggtctgtcc gagaattagc gaggttaaac
    3951  gactacgcta tcgtcggtgt gatagcgact tgattaggat taagattcct
    4001  cggtactcca gcaagactcg tagttgttta ccggggtgtt attatttgta
    4051  cttggacgct aagttcgtta gtcgcgtgta cgaatacgta gttaataatt
    4101  gtgttgtggt gaatgctaag acttttgaat ggacttggaa ctacatcaag
    4151  tcctgtaagt cgagagtggt cattagtggg aaggtcatcc atagagatgt
    4201  tcctatagcg ttggagtatt tggatgggtt ttccgcggtt atgttgtccg
    4251  cgggcgtgaa aggtaggcag aacgcagaag cgttttctag gcgtctggct
    4301  gccttttcag gagatacttc tcttttcgaa ttggtgaggt ttgccgtttc
    4351  agagaagtgt cgcgatttat ttgtgggcat tcaggaggct gtggagaggt
    4401  gcgtgaaatc ataccttagg aactcgttta atatgagttt cgtagacttg
    4451  tcagatcctt tgcttactat tagtgagtac tcggagttag atgttcctat
    4501  cgatttgccg ggtttcggct gcataacaga agaggatgag gctaaactca
    4551  tagaagatgg ggttaagtcg gctttgctac gaaaagcggt tcgtgacgag
    4601  gcgcaactca ttctcgaaag gggtggtacg tcggagatcg ttccttgtgg
    4651  ggatgatgat ggtttgggca gcgatggttc tgacagttca ctcgggtcag
    4701  gtagtgattc gtcctctaaa gctagttctg gtggtttacg tgccggagcc
    4751  gccccttcac tgtttagaag cttactgaag aagttgggcg ggggcttttg
    4801  tgtggccaga aggttattgg acttgttgtg cgagcgatta gttggttcgt
    4851  tgtcgcgcct aaagttcggc accactcatt taacctcatt ctttagcgtg
    4901  ttacgcgcta agctttcgtg taatttcttc gacgactcga tttttaccac
    4951  cgtttgggac acggtaatga acttaattag aatcgttaac ggggtgacca
    5001  agacgaagtt ggagtgtttt cgcaacgtac ttcggttaat acctaagttg
    5051  tgttctggtt gtaaagactt tgcgaaggac tttgcggaca tgtgcaagtc
    5101  agttttgcta ttttctacgg aattcttcag taaaagctat actaaactgt
    5151  gtcggtttag tttggaaata ttcgatgttg gacttattga aatttcagcc
    5201  cgtaatatgg gactggagac ttgtgtttcg atggcttcag ctatttttga
    5251  tgtcatactt acctatcctc tgggaagtat tagctttccc gtcgtttgtg
    5301  cgagagtttt tggcgccctc gctatggaag tgggatcgaa ctattgcttt
    5351  aagaaaactc tcggcaaacc cgaaatttta ggagaggatg cttttcgtag
    5401  aacggtaagt atggtgttga gcgctaaggc tttcgacaaa ctttcagtcg
    5451  atgctaaggg tttagttaga tgttccggta ttattcctgg agtattgagg
    5501  atagtgtttt catctctgtt ttccgatgct gacgcatggg tgggttatag
    5551  caagcacgaa gtttcctcac ttcccatgat cacgtatagt gcgaaaaggt
    5601  tatctttcgt gttggagcag actaaggaag cgtgcatcgc tttcatagtc
    5651  gattcgtcta agagaatctt agcgtctttg acctcggaga ttcacgagtc
    5701  tttgcaaaac tcggaactta ctagtggtgc taaatccttg tatggacgtg
    5751  tgagttctat actctcagca tccaatggaa tggttaacaa ggcaggaaac
    5801  gccgtcgcag cagttaaggc ggcggggagt ggtcttagta aacgtgtgaa
    5851  gcgcattcgt ccttcctttc accttactcg gtgtgttaac gaacagacca
    5901  gcgaatacta ttctgccagt gacgactctg agttggacga gtcgctgctt
    5951  agtgacacac ccggtcttcg tggtaacggg aagtgtaacg atttatttcg
    6001  tgtcgtttcc gggcgtgtct tagtatatcg caggcgcgct gtagaagcct
    6051  tgaagcgttt agtcctacac gtcggtgaat gcttgtactc gcgcattgcg
    6101  gactctttcg tgaggttgtt cgtaagaacc aatactgcag tcgggaagtg
    6151  tgaatccttg gctgtcgact gtgccacaaa aattactgat ttagtagtcg
    6201  gatatatcac ttggcgtaat cttcattttg gtgcgtattc gacaactcca
    6251  gggttatctg gcggtagtag agtttctctt tccaggctct tgggtgatgg
    6301  tctcacgtgt gtaattcaaa atttcgttac cgcgtggttg acgattttca
    6351  atgagacctt ttattcgagt ttggcccatc ggatgaggac tgcctcgata
    6401  aatgtgttgt tagagttcct gaagaacctc ccagtttgtt tagtttcgat
    6451  atacactttc atagagtgta gatctaggat ttttcctttg aaggagtttc
    6501  tttggggctt ttgcattttc gtctggaaca tcatcaaaga actttccgta
    6551  tgtatttacg aaaatcttcc cgtttgcgtt acgaggttgt gtaatagggc
    6601  attccgtcgt agttccaatg aagatgatga gcgcacgctt caagtaatca
    6651  ctgaagctga aaaccgaatt gggtttttgc gagaggttct cgccgaaatg
    6701  gcacggtatc gtgcgtctct cgagattccc gtgccggggt cgcctaacag
    6751  tcctttgttt ccaccgacat acggtgagat tgaggaacta ggtgacggtt
    6801  cttctgatag tgcccgagtg ataggtgtgg acaacggttc agactcaatg
    6851  tccactgaag gggaagcgga actagattcg gatggtgata gcgatgattc
    6901  aatacctttg gatcgtgact ttgagcagat cggaggtctt ggaggaagcg
    6951  gcaacgtcga cgtctttcgt ctagggttga ggttcgtgtg gagaatgtcg
    7001  cgtaatatat ttaacttaag agccgttaaa ttttcttatg gtttagctct
    7051  tcagtgtata tttaacggca gatcgacggg ccagtttata tcgcgactgt
    7101  tattcagttt cggcggctgt ttaccgtttg agttcttcag gcacgtttgt
    7151  gctgtgaggt ggttgtcaag gagcttggca ttacacgttc gtaacgctag
    7201  tatctgcgac gaagaaacgg ttgaatggct tttcaatttt tcgcgatttt
    7251  tgtacgattc gcgttattta tccctcgtgt tttcggagtt ggagagggtc
    7301  gaattttact taagttacct gttctcgttg ccgaagaggt gtttcacgca
    7351  taaccgcagc gttcaagttt gcgttagagc tccagttcgt gtggttaggg
    7401  acgtgggact tgtagaagat ggtaggaagt ctttatccga agtgttgaac
    7451  tctttggact ccttgaaggt gtctaaccgt aaagggaagt cagcggttat
    7501  tgaaagtgat agttccgatt ctgagagcgg tagctcgtcc ggttccatct
    7551  cgttcggatc gattaatgag gaagttttaa aaacggcgaa cggtagcgtt
    7601  gtatctgaaa aagcttcgtt gatgaagcat gcggccgcac taagcgggtt
    7651  ggaaccagat cttggtggta agaaagatct tcctattatt aggagaaatt
    7701  tcacccgcgg tgagtcttca ggtacaaaat cggtagggag cttgtgcgag
    7751  tacttgacga ccttaaattc ctcgttcggt tcggtgccgg acttgtatcc
    7801  cgtcgcacgt gacataacgt acaagaagat gaccaacgcc atgcgtgaat
    7851  tctattattc gcaaaaagta acgttgtatg aacttcatgg aaaattaagc
    7901  tcgtactggg acgagttaaa gacggtgggt ttcgacagga aattggcgaa
    7951  gatggatttg gacgatgacg ttggtgttgt cgattttaac ttgaaggtga
    8001  tagtgggaag gcatggtact cgtcctttca gaaatactgt gaattctcac
    8051  gagttcatgt tttgcgacga cggtttggtg ctttgcccgg gtccgaaaaa
    8101  acgcgatttc gctttgatct ctagtcaaac gcaattcgtt gctgcgaact
    8151  catttctacg tgccgtggac ggcaaagatt tgacgttcac taattcggag
    8201  catagtctta tagtttatga ggctcctccc ggtggtggga agacgcattc
    8251  cttggtaacg tatttcgccg attattgtac taaagtgtct tgcctagtgg
    8301  tgaccgctaa caagaattcg caagcggaga tttctcaaag gatctctaga
    8351  gagttaatgg atagaaaaat gcttgctaaa catgttatta aaaccgccgg
    8401  tagagtgttc accgtggact cttatttgat gaaccatatt cgacttaaga
    8451  ctgacttgtt gtttgtcgat gagtgtttta tggttcatgc tggagcaatc
    8501  ggagcagttg ttgaattcac ttcatgtaag gccgtggttt tcttcggtga
    8551  tagtagacaa attcattaca ttcaccggaa cgatcttggt gtttcgttgt
    8601  tacatgacat agacgcattt atagaaccac agcaccgcat ttacggtgag
    8651  gtgtcttaca ggtgtccttg ggacatctgt gagtggttgt ctaaattcta
    8701  tccgagacat gtagctactg ctaacactgg aagtgtcggg aaatcgagtg
    8751  tgtctataga ggtaataaat ggatgtgacg atgttcctta cgacagtagt
    8801  gcgaagtata tcgtttacac acaagcagaa aagaacgaac tgcaaaagca
    8851  ccttggtcgt ttaaccgtag gccgaactaa agcggtgcct gttgtgaaca
    8901  cagtacatga agttcaaggg gaaacgtata agaaggtccg tttggtaagg
    8951  tgcaaatacc aagaggacac tcctttctgt tcggataatc atgtcgttgt
    9001  ggccttaacc aggcatgtcg actccttaac ttactctgtt ttgaatagta
    9051  ggagatacga caagactgct tctagtatag atgaagcgag ggagattttt
    9101  gacaaatttc gttcgacgaa ccattctcac ggttcctcaa cgttagaatg
    9151  gtacctcgaa aagtatccta ctgaatataa gggtagcaaa gcatcttcgg
    9201  caccgttaag ttgtattaac gagtttctta acgaggtcgt tgtcggttct
    9251  tcggttgtgc agttgggaga cacttctgaa gaattgagtt ctcgcccttt
    9301  tgagtccggg tgtgacaatg ttaccataag ggacactgct cccccagact
    9351  ctggtaattt acacgaaccg gctcgtgttc ggcgtagtaa ggtcgcaggc
    9401  aattccgcca agaaaagcgt ccctacaaga aaatcttctg tcgtacgaaa
    9451  gtcgtaatta caactttata aagacagagc ggtttgtggg gcctgaatgt
    9501  tttggcagag ctatggctgc ggctgttatt gagaggtgtt ttaagatgga
    9551  tgaagtggcc aagataagaa gcgatattat tgctttaact gaggccaata
    9601  ttcaaaaatg gctcgataag cgtactccgt gtcaggtgaa agccgtgcag
    9651  gctgaactga agttaccgtt cgctgtggaa gagcaaatca ctaactacaa
    9701  actaatggtt aagcgtgacg ctaaagtgaa gctcgatgat tcgagtctgt
    9751  cccagcatcc tgccgcgcag aacattatgt ttcataagaa atttatcaac
    9801  gctatttatt ctccatgctt cgatgaattt aagaatagag tgttatcgtc
    9851  actaaacggt aatatagttt tctttactga gatgacgaac gctgggttgg
    9901  cggaagttat caggaggatt ataggcgatg acgacgacct tttcgtcggg
    9951  gaagtggatt tcagtaagtt cgacaagtct caagatttgt tcatcaagga
   10001  gtatgagcgc gcattatact ttgagttcgg gtttgatgac gaacttcttg
   10051  acgtgtggat ggaaggcgag taccgcgcta gggctactac gttagacggt
   10101  cagctgagtt tttcggtcga cggtcaacgc cgttcgggag gttcgaacac
   10151  gtggattggg aactctttgg ttaccctagg tatcctatct ttgtactacg
   10201  acgtctcaaa gttcgagcta ctactcattt ctggcgacga ctctctgatc
   10251  tattcaaaag aaaagattag taacttttct tcagaaattt gtctggagac
   10301  aggttttgaa actaagttta tgtctcctag cgtaccgtac ttttgttcga
   10351  agttcgtggt acaaactggg aacaaaacat gttttgtgcc ggacccttac
   10401  aagctattgg ttaaactggg ggctcctcag tacaaattaa ccgacgatga
   10451  acttttcgaa ctgttcactt cttttaaaga taacactcag gactttggtg
   10501  atcaggtggt cttagagaaa ttgaagttgt tagtagagat taagtacggt
   10551  tttaccagcg gaactactat gcccgctctg tgtgctatac attgcgtacg
   10601  gtccaattat ttatcgttcg agaggttgtt tccctttatc aggggttggt
   10651  atgttgtcga tgctttgaag cttagacaac taaggaagtt cgccaatttg
   10701  atctgtgaac gcgtggttta cgataatcgc gtgggttatt tttcgtactt
   10751  tgacaatacg tttactaaac ccgatgctag cgatggtcaa atggacgact
   10801  tgatgactgg ttgatcgttt gttcaattct cgctgagagc caacgttggt
   10851  agttgagtcg agatgtttgc tttcgcgagc gaaaatcaag acttattaga
   10901  agaaaagata tttcgtcgta gaacgtacca tcgtaagtat ttcgatgatg
   10951  tggttaggga ttttactatc gatgttggtt acgatcttgt tgatcgtgac
   11001  cctacggtat tggctgacta tttctcgtta tatttctttc tgcttaacaa
   11051  cgataacgtt gggcctttag cggcttcaat tgtggtgagc ccgccggtta
   11101  acgggactta taaaattcga gcgcacgtcg ataatcaacc aaattgcgaa
   11151  ggaaacgtga cttacattaa aactaccgat aagagtcgtt ttgcgatcct
   11201  cataaaggca gtcccggctc ctatgagagg ttattactct tttcgggcgt
   11251  tccttgccgc tgatgtcact agcgaacgca gtgaattcat atgcagtttt
   11301  gtcggtagta gattcctttg ttgttgtacg caaacgatat ccgaaaattt
   11351  gagtaaggtt tgttcgtctt ctttctcttt tagagctgtc tcaaaaaccg
   11401  caattaacga gttttctgtt gcgattgatg atgtggaaga cgttaagtat
   11451  gtgagaaagc gagctgaggg tttctcacat tgcgccgacc catacccccc
   11501  taggtgttat cgcggtacta atttaggcga ttcttcaggg gttcaaagtc
   11551  gtacaatcga ggaagaaggt tataggacag ataccgcagg taacgtcgcg
   11601  gtctctatcc cgaacacccc actcgttaat gctgtctctc cgtatgtcgc
   11651  agagtacaac gaaaatacgc gttcgcgtat ctcgttgata cgccgagtct
   11701  gttgttacgc tgtttgtgtt ttagtggtgt ctcttcttat aatgagcggt
   11751  ttgttagcca ttatattcat atgatttgat gaagtaaatt acgaggtgca
   11801  attagctaaa actcaccgtt tgactctgtt taaacgggtt tcaatggact
   11851  gtgtgattca aggatttttg acttttctgg ttggtatagc tgtgttttcg
   11901  gcctttgccg gactgattat cattgttata acgatttatc ggtgcacgac
   11951  taagcctgtt aggaacactt ctccttacgg cactcacgcc actgtctaag
   12001  cggtatggta cttctgggtt tagactttgg taccacgttt tcgacggtgg
   12051  ctatggctac atcctctgag ttagttatac tcaaacaatc taattcatcg
   12101  tacataccta catgtttgtt tttgcatgca gaccctaaca gcgtgtctta
   12151  tggttacgat gcggaatatt tagcggcttc tggggagcct ggttcttttt
   12201  acaaagattt gaaacggtgg gttggttgca ctgcgaagaa ctaccaaacc
   12251  tacttacaca aactatcgcc ttcctataag gtgacggtgg aagagtttgg
   12301  aactaagagt gtgccagtcc catatttgtc acctctgaat aacaatttgg
   12351  gactcaatgt cgctttacct ttactaatcg cttcgtatgc caaatgcatt
   12401  ttgtcggatg cggaacgagt gttcaatgta agctgcactg gagttatatg
   12451  ttcggtaccc gctggttata acacgttgca acgagctttt acgcagcaga
   12501  gtatatcgat gtcgggttac tcttgcgtgt acattattaa cgaaccttca
   12551  gcagccgcgt actccacttt acctaagttg agttcggcag ataaatattt
   12601  agccgtttac gacttcggcg gtgggacttt cgacgtctct atagttagcg
   12651  tcagattgcc tacgttcgcc gttaggagtt cgggtggtga catgaattta
   12701  ggtggtagag atatcgacaa aaagttatct gataaaatat acgaaatggc
   12751  agattttata ccgcaaaagg aattgaacgt ttctagttta aaggaagctt
   12801  tatctcttca aactgatccg gtcaaatata ctgtaactca tcacggaatg
   12851  agtgagacga tatcaattga tcaaacggcg ttgagggaga tagcttcggt
   12901  gttcataaat cgaacgatag atatacttac gcaagttaaa gttaagtcta
   12951  gtatgcccga atcgcaaagt ttaaagttag tggtagtcgg tggaagctcg
   13001  tacctaccag gattgttgga tactttggca accgtgcctt tcgtgtctgg
   13051  gatagtacta gtggaagacg caagaaccgc ggtcgctaga gggtgtgctt
   13101  tatatagtga gtgcttagat ggtaggtcca aggccctact aatagattgt
   13151  attacacatc atttgtcggt tacgacgttt agcgcggact cggtcgttgt
   13201  cgcagcggcc ggtagtccaa ttccttttga aggagaacga aaactcacgt
   13251  tacgcaaatg cgttagcacg tctaactatc aagcaagaat gtttgaagga
   13301  gattacgaaa aggttttccg aaatgaacgt atctacgcag cttcagtatc
   13351  gttgtttact ttaggagtta attggcgtgt gcctaccgac gttgaaatga
   13401  ctctcgtgac caaagtggac tcaatgggta aagtggaatt ttaccttaaa
   13451  ggtccatctg gtgaactagt caacgtgcaa ggtacttcgc attacgatta
   13501  tactggtatg cctcacccca ctagaaattt ggtgaagctt agcgattaca
   13551  atgtaaactc cgccgcttta gttttagctt tgacattaac tcgcgaaaaa
   13601  cgagaaaagt ttcttttgcg gacattattt gacactttac tagcagattt
   13651  gcgaaggaca gcaagtttga gcgagtactc aaagaagtac ccgatcactc
   13701  gaaacgatat cgatgtcgtc tcatcacgta tggggatcgt tgtttcgaaa
   13751  gttttacggg gaagcgattt ggaaagaata cctctctgaa tcaactcgaa
   13801  gttttgatga aagaaacgtg tcgttggacc acactttgag ttcgggtgtg
   13851  gtcgtccgta ggcagagtct tttgaatgcg cctcaaggga ctttcgagaa
   13901  cgagttagcg ctattgtata attcggtggt gattaacgat tttgttgagt
   13951  tgactggtat gccattgaag tctttgatga caggtatcga ggaccgtaag
   14001  gtgcctgacg aattaatatc cgttgacccg cacgaagtcg gatgtagatt
   14051  cacgttaaac gacgtggaat catatctaat aagcaggggc gaggattccg
   14101  ctgatgtaac ggcggtcgag cattcgtggt gtttgagtaa ctcttgtggt
   14151  agactattaa gttcgaccga gatagatgct tacaaaacct tggtgtttac
   14201  caagaatttc gatagtaatg tatctggagt gactactaag ttagagactt
   14251  atctatcgta ctgtatatct ttgtacaaga aacactgcat gaaagacgat
   14301  gattatttta atcttatcac acctatgttt aattgtttgg tgaaagtgct
   14351  ggcgtcactt ggtttgtttt atgagaaaca tactgacaat ccgctactga
   14401  ccggaatgct tatagagttt tgcctagaaa ataaggtgta ttactctact
   14451  tttaaagtaa atttagacaa cgttagattg tttaagtcta aagtgttgcc
   14501  tgtggtgtta acggtttggg atatatctga gcctgatgac ccagtggatg
   14551  aaagggtgct aattcctttc gatcctactg atttcgtgct cgatttacct
   14601  aaattgaata tacacgacac aatggtggtg gtgggtaatc aaatcagaca
   14651  gttagagtac gtagtcgaga gcgatgcttt agacgattta tctcaacacg
   14701  ttgacatacg tttagcagcg gacaaccccg atctacgcgt tgatctgcgt
   14751  tgggcaggga tgtttgtcta ctacggtgtt tatcggtgtg ctattgatag
   14801  agtggtagaa cgaccggcgt tatttagatt gccgcagaag ttattgagtc
   14851  aggatgatgg cgaatcgtgc tcattgcgca tgagtgccgt cgaagcttta
   14901  tttaatctag tgcaaaaggt gaacagggac ataaacgtta gacgtcagtt
   14951  catgggacgt cacagtaaag tggctttgcg actgtatcgc aacttaggtt
   15001  tgaggtttcc accgatctct tcagttaggt taccggttca tcacggttac
   15051  ttatacgtcg atttttacaa aagagtacct gacgatgctg ttactgccga
   15101  cgaactcgaa agtttacgtc aattacgttc gtccgtggac gttatgtgta
   15151  aggacagggt gtcaatcaca cctccaccat tcaatcgact tagaagaggt
   15201  tcttctagaa catttagagg tcgaggcgca cgcggtgcga gctcgcgtca
   15251  tatgagcaga gacgtggcaa cttccggttt taatttacct tatcatggca
   15301  ggttatacaa cacttcctaa taccgatgac aaagaaatgg atccggtgag
   15351  tgccgctgta cccggtaagt atccggatgt cattgaaaaa tttgtggcca
   15401  acaggtccgt agacgcgtta atagaaggcg tcataagtaa gttggatacc
   15451  aattcaatat acgaagattc cactgaaaaa tttactggtg aacacttgaa
   15501  atacgttatg gttactatgg atgctttctt attagaaaac tacaagacga
   15551  aaacggaaga tctgttggtt cacttagcta tgatccaaaa gaggttgtac
   15601  actacatcca cgagcactaa aaccaagttc cgcgataaag gttgtattag
   15651  ttacgtgcaa gggggttcgc gatataagtt aatggataaa gtagtttttc
   15701  ctttcattat atcgaaattt accgacaggg agactccgaa cgctctacgt
   15751  aagtatgctt gcactttcga ggagttacac ttgtgtatgg ctaggttgag
   15801  acccgactta tacgaaaata aaaggacgac taaagccggg actccacatt
   15851  taaagggcta tttatcagcc gactttcttt cgggttctct cccaggatac
   15901  tccgaacatg aacgaggcat cattcttcga gcgtctgagt ctatgttagc
   15951  tagacgtcaa ggttacgagg aggcaaccga gcttcttaac ctacgtgatt
   16001  tgggtaagta cttgtagttg gtttggggac ggtaatatta ttattatacc
   16051  atcccttgag cgctgcttta agggtcgtta attgacgact cttgatatat
   16101  ttactaggtt tgaattatgg acgacgaaac aaagaaattg aagaacaaaa
   16151  acaaggaaac gaaagaaggc gacgaagttg ttgctgctga gtcttctttc
   16201  ggttccgtaa acttacacat cgatccgact ctgataacga tgaacgatgt
   16251  gcgtcagttg agtactcaac agaatgctgc tttgaacagg gacttatttc
   16301  ttgctctgaa agggaagtat cctaacttgc ctgacaaaga taaggacttt
   16351  cacatagcta tgatgttata ccgattagcg gttaagagtt catcattgca
   16401  aagtgatgat gacaccacgg gcataacgta cactcgggag ggtgttgaag
   16451  tagatttgtc tgacaaactt tggaccgaca tcgtgtataa ttctaagggt
   16501  attggtaacc gaactaacgc ccttcgagtc tggggtagaa ctaacgatgc
   16551  tctttactta gccttttgta gacagaaccg caatttgagt tatggcggac
   16601  gtccgctaga tgcagggatt ccggctgggt atcattattt gtgtgcagat
   16651  ttcttgaccg gagctggctt gactgattta gaatgtgctg tgtacataca
   16701  agctaaagaa caattgttga aaaagcgagg ggctgatgag gttgtagtta
   16751  ctaatgtcag gcagcttggg aaatttaaca cacgttgatc tattgcgttc
   16801  cgattcccgg tttctatcgg gatggtggag tttcatcgtg aacgtgggtg
   16851  atataattgt ccggttcgcg ttacacgttc ctaatgaaga tatgctgaat
   16901  agtttttcag ctatatcgaa ttgtacgatt atagcggatg gtagtgcttt
   16951  actaaaggac aatactgtgg ttgaccgttt agaaagcatg aatcctttgg
   17001  cttatttgtt aaaattagcg aaaacgacta ctactatttg ttttaccatg
   17051  tccaataagg ttctttttgg tactaccaaa tccgaaccac ttagttgttt
   17101  agctatcacg tcggatcgag ttttattcaa agttattatg ggcgctaacg
   17151  ttgatgattc tcggtgcggc tgcagtattt ggttttacaa caatggtacg
   17201  tttcaaaacg gattgacccg ttgtaataat ctcgtcactt tgtttagcgc
   17251  gacttagaca cgaagtgacc gttcggattt aattgctgcg atgagtattc
   17301  gacgcgtgtg gttaaaggtt atagctgtaa ttacagtgtt gtggtacggt
   17351  aaggaacctt ctattagtga aggttacaat gctcttatga atgacgactt
   17401  taaatttatc gatacgcatt tttctaacgt ttcttatgct aagaaatgtt
   17451  acgatttggc taatttcgat ttagactttt tgcgcatcgt tatcattcct
   17501  ttgagtggtg gcacggcgaa tgagtcgcgt tctgatcgca ctaacgtttc
   17551  agagattgtc gaatcgcatg taagcgaccg agacagaatg cacatcttgt
   17601  tgcgtaataa gcggatccag attccttcgc tcttaccttg cgataactag
   17651  agtctactca gtagtacgtc tactagtata acgtgttaaa cactttagtg
   17701  aggagttttg tttgaatcaa acaatatgcg agcttacttt agtgttaacg
   17751  attacataag ccttttggct aaggttggtt cagttgtgga acgtttgtgc
   17801  gatcccagcg taactctcac ggaagtgatg gacgaaatta atgattttaa
   17851  ctcgtttctc gctttggtgc actctatgaa gtcggacatg aacggcgatc
   17901  atcaggatgg tcaccatgag atgggtgaac ataaatctcg gttgttgtgc
   17951  aatatagagg cgaaactgcg agtgcttctc gacatcataa gacgtcggtt
   18001  tactcgcgaa aaactgctct gtaccagtgc tacagatgtt gtgggcttct
   18051  tcgtcgtgag gtacatgagt tctagtcaca ctagtttcga aaccgtaatg
   18101  cgaacggaac tgaagttggt ggttaaagct gtgctgtcgg aattgtcccg
   18151  cacgcataaa ctagatttta gcgagcgagc ctttacggct tacggtatcc
   18201  ttttgcagaa gggcaccgtg gcaaccgttt gcggtcagtt tgacattaat
   18251  ttagtttctc cgtcttgcgt gtaggttaat acgcttctca gaacgtatag
   18301  ttgtattaac taactttgat tcgaacatat ttattgttta aagtctgtaa
   18351  gttacgatgg atgatactag cggacaaact ttcgtttctg tgaacctttc
   18401  tgacgaaagc aacacggcaa gcactaaagt tgaaaacgta aaatcggaag
   18451  cggatcgctt ggagttttta cgtaaaatga atccctttat tgttgacgct
   18501  ctggtgcgga aaaccaatta tcagggtgct cgctttcgcg caagaataat
   18551  aggagtgtgc gtggattgtg gtagaaaaca cgacaaggcg ctcaagactg
   18601  aacgtaagtg taaggtcaac aacacgcaat ctcagaacga ggtggcgcat
   18651  atgttgatgc acgatcccgt taagtatttg aacaaaagaa aggctagagc
   18701  cttttctaac gcagagatgt ttgcgattga actggtttcg tacaccaagg
   18751  aaaggcaatt ggcggtcgat ttagccgctg aaagggagaa gacgagactg
   18801  gctcgtagac acccaatacg ttctccggaa gaaactccgg aacattataa
   18851  attcggtatg actgctaagg caatgttacc ggacatcaac gccgtagacg
   18901  ttggtgataa cgaggaaact tcgtcggagt acccagtgag tctgagtgtt
   18951  tctggcggag ttctccgtga acaccacttc atctgattga agtggacgga
   19001  ataagttcct tgcggaactt taagtcgggt tggtaaaaac cctttatgat
   19051  ggtgatgtat cactagacaa taaccggatg ggtaaagtct ttaaaatgat
   19101  cgaggggaaa attaaccgta tcctctcgtt ggtctaagct cccacagagt
   19151  ggtagtggtc tcaagtgagg cttaacgtat gcgtgaacca aagaagttct
   19201  ccttagagtg tgtgttgttt accaacacac tgtccctatg gggggcccaa
   19251  cataggtcca