Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate PA3 major coat protein gene, complete cds.

ACC No: EU939685

Dated: 2009-02-11 | Length: 672 | CRC: 898138610

                
ID   EU939685; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU939685;
XX
DT   11-FEB-2009 (Rel. 99, Created)
DT   11-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate PA3 major coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Martinez S.T., Oliveros-Garay O.A., Guzman M., Acosta O.;
RT   "Molecular cloning and nucleotide sequencing of the coat protein gene of
RT   two Citrus tristeza virus isolates from Colombia";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Martinez S.T., Oliveros-Garay O.A., Guzman M., Acosta O.;
RT   ;
RL   Submitted (02-AUG-2008) to the EMBL/GenBank/DDBJ databases.
RL   Departamento de Quimica, Universidad Nacional de Colombia, Carrera 30
RL   45-03, Bogota DC, Cundinamarca 14490, Colombia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="graft of sweet orange on Cleopatra mandarin"
FT                   /isolate="PA3"
FT                   /mol_type="genomic RNA"
FT                   /country="Colombia:Meta-Villavicencio"
FT                   /collection_date="Feb-2002"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /note="CP"
FT                   /protein_id="ACM66949.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFSRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVHIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 126 C; 173 G; 175 T; 0 other;

eu939685 Length: 672  11-FEB-2009  Type: N  Check: 9276  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggagt tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  agtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agacttcttg accggagctg
     551  gcttgactga cttagaatgt gctgtgcaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga