Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CTV-D13 coat protein gene, complete cds.

ACC No: FJ001829

Dated: 2011-09-04 | Length: 672 | CRC: -223841937

                
ID   FJ001829; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   FJ001829;
XX
DT   04-SEP-2011 (Rel. 110, Created)
DT   04-SEP-2011 (Rel. 110, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CTV-D13 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Biswas K.K., Dwivedi S., Tarafdar A.;
RT   "Molecular characterization of citrus tristeza virus from India";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Dwivedi S., Biswas K.K., Tarafdar A.;
RT   ;
RL   Submitted (06-AUG-2008) to the INSDC.
RL   Plant Pathology, Indian Agricultural Research Institute, New Delhi, Delhi,
RL   India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /isolate="CTV-D13"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Delhi"
FT                   /collection_date="2008"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACN32223.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLIKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 123 C; 170 G; 181 T; 0 other;

fj001829 Length: 672  04-SEP-2011  Type: N  Check: 3704  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtatga cgtacactcg ggaaggtgtt gaagtggaac tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agatctaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtaca tacaagctaa agagcaatta
     601  ttgataaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga