Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CTV-D15 coat protein gene, complete cds.

ACC No: FJ001831

Dated: 2011-09-04 | Length: 672 | CRC: 1842527147

                
ID   FJ001831; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   FJ001831;
XX
DT   04-SEP-2011 (Rel. 110, Created)
DT   04-SEP-2011 (Rel. 110, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CTV-D15 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Biswas K.K., Dwivedi S., Tarafdar A.;
RT   "Molecular characterization of citrus tristeza virus from India";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Dwivedi S., Biswas K.K., Tarafdar A.;
RT   ;
RL   Submitted (06-AUG-2008) to the INSDC.
RL   Plant Pathology, Indian Agricultural Research Institute, New Delhi, Delhi,
RL   India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /isolate="CTV-D15"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Delhi"
FT                   /collection_date="2008"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACN32225.1"
FT                   /translation="MDDETRKLKNKNKETKEGGDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQWGTQQNAALNRDLFLTLKGKYPSLSDKDKDFPIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 188 A; 124 C; 180 G; 180 T; 0 other;

fj001831 Length: 672  04-SEP-2011  Type: N  Check: 3460  ..

       1  atggacgacg aaacaaggaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcggcgat gttgttgcag cagagtcttc tttcggttcc gtgaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgcca gtggggaacc
     151  caacagaacg ccgctttgaa cagagatttg tttcttactc tgaaagggaa
     201  gtatcctagc ttgtctgaca aggataagga cttccccata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggcataa catatactcg ggagggcgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggatatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga